Entry information : PgrGPx01
Entry ID 10034
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PgrGPx01
Name PgrGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Puccinia graminis f. sp. tritici    [TaxId: 56615 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgrGPx01
start..stop
S start..stop
PUtriGPx01 325 3e-115 29..210 1..181
CqueGPx01 261 1e-90 49..210 2..163
MlpGPx01 256 3e-88 53..210 6..163
RsolGPx01 229 9e-78 50..208 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1412843..1412869 27 N° 2 1412457..1412716 260 N° 3 1412212..1412325 114 N° 4 1412020..1412116 97
N° 5 1411830..1411862 33 N° 6 1411707..1411753 47 N° 7 1411574..1411628 55  
complement(join(1411574..1411628,1411707..1411753,1411830..1411862,1412020..1412 116,1412212..1412325,1412457..1412716,1412843..1412869))


exon

Literature and cross-references PgrGPx01
DNA ref. JGI genome:   supercontig_2_14 (1412869..1411574)
Protein sequence: PgrGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   22994.54  
PI (pH):   %s   7.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSSLHGAGDGSAGEVEYVIQAEAGLSSMKRLSSLLNHLQPPSPTTHASMAQFYNLKAILANGTEFDFAQTKGKVVLVVNVASKCGFTTQYEGLEKLWQKFKDKDFQLIGFPCNQFGGQEPGTDSEIASFCKLNYGVTFPIAQKCDVNGDNAHPVYNFLKSEKSGMGLSRIKWNFEKFVVDKKGAVRYRHASTSKPESLEKEIEGLLAE

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCCTCGTTACACGGAGCCGGGGTATGTAGAAGCCAGGAAGAAACAAGCAAATCAAACCGAATCCGCCCCAAATTGATGCACATTCAAATCAATATGCATTTACATATACATATG
TACATACATAAACGCATACATACATACACACAGGACGGCTCGGCGGGGGAAGTTGAATACGTCATCCAAGCTGAAGCAGGCTTATCATCGATGAAAAGACTATCATCACTGCTCAACCAC
CTCCAACCACCCTCACCAACCACACACGCAAGCATGGCCCAGTTCTATAACCTCAAGGCAATCCTTGCCAACGGTACCGAGTTCGACTTCGCTCAGACCAAAGGGAAAGTCGTCTTGGTC
GTCAACGTCGCTTCCAAATGTGGCTTTACTACTCAGTACGAAGGACTTGAAAA
GTTAAGCTTCTGTTCACTTGGCTCCTTTTTTGTTAAAAGATTCCTCTGAATATTCTTTATTTCTTGT
TCGTCACCCCACATGTGCAATCAACTTATCATCTGGCTCACGCTCCTTTTTTTTTCTTATCTAGATTGTGGCAAAAATTCAAAGACAAAGATTTTCAATTGATTGGATTTCCTTGTAATC
AATTCGGAGGACAAGAGCCAGGTACAGACTCAGAGATCGCCAGTTTCTGTAAACTCAA
GTTAGTACTTTCGATCATGACCACCATCAATTGAAACCTTTTATCCATCCTCTTCTACAATT
GTTTGCTTACTCGATTCTATATTTCGGATATAGCTATGGTGTTACCTTTCCGATCGCTCAAAAGTGTGACGTCAATGGCGACAATGCCCATCCAGTTTATAACTTCTTGAAGAGTGAAAA
ATCAGGAATT
GTGAGTCTCGTCGAAGTTAGACGATCACCATCGGCATGGCTTTCCTTCTTCTCCCTTTCCGATCTAATATTCAACACAATCCCTCGTGTTTTTTTTATTTCATTTCATCA
ACTGACCATATGACTTTTACACGCTTTCAATTGATCATCAATGATAGATGGGACTCTCACGAATCAAATGGAACTTCGAGGTATGATACATACAAACATCTTGACAATATGTCCTCCAAA
ACATAGGCTAACGTTCTTGAATCCAACTTTGTGTAGAAATTCGTTGTGGACAAGAAAGGGGCCGTTCGTTATAGACATGCCTCGTGAGTACTAATCTGTTTTTGATTAGGTAAAGTCAAA
ACATAACCCTTAAATATACGTATCATTTTATTTTATTTTAGGACTTCTAAGCCTGAGTCACTTGAAAAGGAGATCGAAGGTTTGTTAGCCGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCCTCGTTACACGGAGCCGGGGACGGCTCGGCGGGGGAAGTTGAATACGTCATCCAAGCTGAAGCAGGCTTATCATCGATGAAAAGACTATCATCACTGCTCAACCACCTCCAA
CCACCCTCACCAACCACACACGCAAGCATGGCCCAGTTCTATAACCTCAAGGCAATCCTTGCCAACGGTACCGAGTTCGACTTCGCTCAGACCAAAGGGAAAGTCGTCTTGGTCGTCAAC
GTCGCTTCCAAATGTGGCTTTACTACTCAGTACGAAGGACTTGAAAA
ATTGTGGCAAAAATTCAAAGACAAAGATTTTCAATTGATTGGATTTCCTTGTAATCAATTCGGAGGACAAGAG
CCAGGTACAGACTCAGAGATCGCCAGTTTCTGTAAACTCAA
CTATGGTGTTACCTTTCCGATCGCTCAAAAGTGTGACGTCAATGGCGACAATGCCCATCCAGTTTATAACTTCTTGAAG
AGTGAAAAATCAGGAATT
ATGGGACTCTCACGAATCAAATGGAACTTCGAGAAATTCGTTGTGGACAAGAAAGGGGCCGTTCGTTATAGACATGCCTCGACTTCTAAGCCTGAGTCACTT
GAAAAGGAGATCGAAGGTTTGTTAGCCGAATAA

Retrieve as FASTA