Entry information : HcyGPx01
Entry ID 10038
Creation 2011-12-28 (Passaia Gisèle)
Last sequence changes 2011-12-28 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyGPx01
Name HcyGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyGPx01
start..stop
S start..stop
GmarGPx02 320 6e-113 2..208 11..213
HsubGPx01 313 2e-110 45..208 47..210
PstrGPx01 298 1e-103 36..208 80..254
LameGPx01 295 3e-103 30..208 18..192
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 711749..712002 254 N° 2 711660..711682 23 N° 3 711530..711597 68 N° 4 711302..711475 174
N° 5 711131..711238 108  
complement(join(711131..711238,711302..711475,711530..711597,711660..711682,7117 49..712002))


exon

Literature and cross-references HcyGPx01
DNA ref. JGI genome:   scaffold_14 (712002..711131)
Protein sequence: HcyGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   209
PWM (Da):   %s   23073.69  
PI (pH):   %s   8.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLLSTVTLNCINRPSVHKSLFLTCSLLPTTTCSSHLNPFSRPAYSTMSESGFYSLKAELPGGKEYNFADLKGKTVLIVNVASKCGFTPQYGLQALYDKYKDQGLEILGFPCNFGGQEPANDEGIAEFCTLNHGVSFPLMRKSDVNGDNTNEVYKWLKSEKSGLLGLTRIKWNFEKFLVDKNGNVVERWASTTTPQAIDAEIAKIL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Scaffold_14:711058-712106 (-), 4 introns). No EST. Strain "h7".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGATTGCTCAGCACTGTCACTCTCAACTGCATAAATAGGCCGTCTGTTCATAAATCTTTGTTCCTTACTTGTTCACTGCTTCCCACCACCACCTGCTCGAGCCATCTAAATCCCTTC
TCTCGCCCCGCCTATTCTACCATGTCTGAATCTGGATTCTACTCCCTCAAGGCTGAGCTTCCCGGCGGCAAGGAGTACAACTTTGCCGATCTCAAAGGAAAGACGGTCTTGATCGTCAAT
GTCGCTTCGAAATG
GTGCGCAATATGCTTCATTGGGATCACCCTGAATGCTTATTGACATTTCCTGTCCACCCAATATAGTGGCTTCACGCCCCAATATAAAGGTACACCTTGAACGGCG
ATTCTCTTCCAGGAAGAGCTTATGTATCCGCCCTCTCTCGTTTAGGTCTCCAGGCCCTGTATGACAAGTACAAAGACCAAGGTCTCGAAATTCTTGGTTTCCCATGCAATCAGGTGTGTC
TTGTTTACAAACCAGAAGAGAGATTCGGCCTTAATCCATCCTTCAAGTTCGGTGGCCAAGAGCCCGCAAACGACGAAGGGATCGCCGAGTTCTGCACGCTCAACCACGGTGTCAGTTTCC
CCTTGATGAGGAAGTCGGATGTCAATGGCGACAACACCAACGAGGTGTACAAGTGGTTGAAGTCCGAGAAGTCCGGTCTTTTGGGCTTAACCCGCATCAAG
GTGCGTTTGAATGCTTCTT
TGTTATAACGGGCGATTCGATTACTGACGGCTCTTCCGGTGTAGTGGAACTTTGAGAAATTCCTCGTCGATAAGAATGGCAACGTCGTCGAACGATGGGCGTCCACCACAACACCCCAAG
CAATCGACGCTGAGATTGCGAAGATCCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGATTGCTCAGCACTGTCACTCTCAACTGCATAAATAGGCCGTCTGTTCATAAATCTTTGTTCCTTACTTGTTCACTGCTTCCCACCACCACCTGCTCGAGCCATCTAAATCCCTTC
TCTCGCCCCGCCTATTCTACCATGTCTGAATCTGGATTCTACTCCCTCAAGGCTGAGCTTCCCGGCGGCAAGGAGTACAACTTTGCCGATCTCAAAGGAAAGACGGTCTTGATCGTCAAT
GTCGCTTCGAAATG
TGGCTTCACGCCCCAATATAAAGGTCTCCAGGCCCTGTATGACAAGTACAAAGACCAAGGTCTCGAAATTCTTGGTTTCCCATGCAATCAGTTCGGTGGCCAAGAG
CCCGCAAACGACGAAGGGATCGCCGAGTTCTGCACGCTCAACCACGGTGTCAGTTTCCCCTTGATGAGGAAGTCGGATGTCAATGGCGACAACACCAACGAGGTGTACAAGTGGTTGAAG
TCCGAGAAGTCCGGTCTTTTGGGCTTAACCCGCATCAAG
TGGAACTTTGAGAAATTCCTCGTCGATAAGAATGGCAACGTCGTCGAACGATGGGCGTCCACCACAACACCCCAAGCAATC
GACGCTGAGATTGCGAAGATCCTATGA

Retrieve as FASTA