Entry information : MguPrx[P]111
Entry ID 10048
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: MguPrx[P]111
Name MguPrx[P]111
Class Class III peroxidase     [Orthogroup: Prx017]*
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx[P]111
start..stop
S start..stop
MguPrx90 272 4e-93 1..163 1..185
HarPrx17 120 1e-34 41..162 46..184
EcamPrx100 121 3e-34 39..162 43..183
NtPrx81-1A 120 4e-34 39..162 39..179
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10770..10814 45 N° 2 10974..11124 151 N° 3 11204..11237 34 N° 4 11293..11388 96
N° 5 11532..11690 159  
join(10770..10814,10974..11124,11204..11237,11293..11388,11532..11690)


exon

Literature and cross-references MguPrx[P]111
DNA ref. Phytozome 12:   scaffold_98 (10770..11690)
Protein sequence: MguPrx[P]111
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163 (144)
PWM (Da):   %s   17718.23 (15603.1)  
PI (pH):   %s   7.43 (7.02) Peptide Signal:   %s   cut: 20 range:20-163
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ILLIFLSSVLFFCFSATRGTIHIHHTRFVPERRGHCQPSxVNRAAIDNSRVSLILLQLYFHDSFVEGCDGSILLxQRADSECKTSTRICLPDVVSCVDIVVMAARDAIVLTGGPIYAVETGRRDVTVSSRLLATDMPDSRDSVDILKSKFFSKKLSEAELVID

Retrieve as FASTA  
Remarks Pseudogene from genomic (Both 5' end and 3' end are missing; Gaps in frame). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTTTATTAATTTTCTTAAGCAGTGTTTTATTTTTTTGCTTTTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCTACTCGTGGTACAATTCATATTCACCACACGCGC
TTCGTGCCCGAACGCCGAGGCCATTGTCAGCCAAGTGNNGTGAACCGAGCTGCCATCGACAACTCTCGTGTGTCGCTGATTCTTCTCCAACTGTATTTTCACGATTCTTTTGTCG
AGGTT
TTTTTGTTTTTTTTCTTTCTTTCAATAATTTTATTTATGATATATTTATCCATTTCTGTTTTCTTTTCACTTTGAGGGCTGCGATGGTTCTATTTTGCTTANNCAAAGGGCATAGACCAA
CCCAAGAAGGAAGCACTTGGCCATCAAGGAGTCCAATGATTTCTTGAGATAGCGAGTGCAAAACAAGCACTCGAATCTGCCTGCCCGATGTTGTTTCGTGTGTGGACATCGTTGTTATGG
CCGCACGAGACGCCATCGT
ATTGGTAATTTCTTTCTTTTTTTCTTTTTAGAAATTCCAATTGAAATATGTGGGGATGTGAACTGAATTGGTAGATAATTAGTTGTGGTAATTATTTTTCA
ATTGAAAGTAAATAAATATTTTTTTTTCTTTTTTCTTTACCCCTAGACTGGTGGACCGATTTACGCAGTCGAGACCGGGAGAAGGGATGTCACGGTTTCAAGTAGATTACTTGCAACCGA
CATGCCTGACTCTCGCGACTCAGTAGACATCCTTAAGTCCAAGTTCTTCAGCAAAAAACTTTCCGAGGCCGAGCTCGTCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTTTATTAATTTTCTTAAGCAGTGTTTTATTTTTTTGCTTTTCTGCTACTCGTGGTACAATTCATATTCACCACACGCGCTTCGTGCCCGAACGCCGAGGCCATTGTCAGCCAAGTGNN
GTGAACCGAGCTGCCATCGACAACTCTCGTGTGTCGCTGATTCTTCTCCAACTGTATTTTCACGATTCTTTTGTCG
AGGGCTGCGATGGTTCTATTTTGCTTANNCAAAGTTGAGATAGC
GAGTGCAAAACAAGCACTCGAATCTGCCTGCCCGATGTTGTTTCGTGTGTGGACATCGTTGTTATGGCCGCACGAGACGCCATCGT
CTAGACTGGTGGACCGATTTACGCAGTCGAGACC
GGGAGAAGGGATGTCACGGTTTCAAGTAGATTACTTGCAACCGACATGCCTGACTCTCGCGACTCAGTAGACATCCTTAAGTCCAAGTTCTTCAGCAAAAAACTTTCCGAGGCCGAGCTC
GTCAT

Retrieve as FASTA