Entry information : AalcGPx01
Entry ID 10061
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2016-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-02 (Achraf Jemmat)
Peroxidase information: AalcGPx01
Name AalcGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Acremonium
Organism Acremonium alcalophilum    [TaxId: 398408 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalcGPx01
start..stop
S start..stop
CfioGPx01_MH18 313 3e-109 73..248 66..241
CgraGPx01 313 4e-109 73..248 61..236
ChigGPx01 310 5e-108 73..248 65..240
CgloGPx01_ST23 302 6e-106 81..248 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4093978..4094260 283 N° 2 4094335..4094804 470  
join(4093978..4094260,4094335..4094804)


exon

Literature and cross-references AalcGPx01
DNA ref. JGI genome:   scaffold_1 (4093978..4094804)
Protein sequence: AalcGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27987.32  
PI (pH):   %s   10.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAPIGRSASLPVTQCLRDLRRSLPSFHSRRSIVSDIHTTRRLFSVYTLHRTTSATALRSPSTRNHSPSHLRQTRTKADMSSATTFYDFKPLNNRGQEVPLSDYKGKVVLIVNTASKCSFTPQYAGLESLYKSIREKRGEDFAMLGFPCNQFGAQEPGSDEDIQQFCQVNYGVSFPMMKKIDVNGDAASPLFTWLKEEKPGIMGLKRVKWNFEKFLVGRDGKVKGRWASTTKPESLEAAILAELDAKAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_1, 1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTTGCACCGATTGGAAGAAGCGCTTCACTTCCAGTCACTCAATGTCTCCGTGACCTTCGACGTTCTCTTCCCTCGTTCCATTCTCGCCGCTCTATCGTCTCCGACATCCATACA
ACCCGCCGTCTATTCTCCGTCTATACCCTACATCGTACGACCTCGGCCACGGCATTACGATCCCCCTCGACTCGCAACCACTCCCCTTCTCATCTCCGCCAAACCCGAACCAAAGCAGAC
ATGTCTTCCGCAACTACCTTTTACGACTTTAAACCCCTGAACA
GTACGCAATCCCCCTCCCTCGGCCCCTTCTCAATCAAGAAAAGCCCCCGCTAACCCGGCACCCACGCTCGACAGACC
GCGGCCAGGAGGTCCCCCTATCCGACTACAAAGGCAAGGTCGTCCTCATCGTCAACACGGCCTCCAAGTGCAGCTTCACCCCGCAGTACGCCGGCCTCGAGTCGCTCTACAAGTCGATCC
GCGAGAAGCGCGGCGAGGACTTTGCCATGCTCGGCTTCCCCTGCAACCAGTTCGGCGCCCAGGAGCCGGGCTCCGACGAGGACATCCAGCAGTTCTGCCAGGTCAACTACGGCGTCTCCT
TCCCCATGATGAAGAAGATCGACGTCAACGGCGACGCCGCCAGCCCGCTCTTCACGTGGCTCAAGGAGGAGAAGCCCGGCATCATGGGCCTCAAGCGCGTCAAGTGGAACTTTGAAAAGT
TCCTCGTCGGCCGCGACGGGAAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGAGCCTCGAGGCGGCTATCCTTGCCGAGCTCGATGCCAAGGCCGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTTGCACCGATTGGAAGAAGCGCTTCACTTCCAGTCACTCAATGTCTCCGTGACCTTCGACGTTCTCTTCCCTCGTTCCATTCTCGCCGCTCTATCGTCTCCGACATCCATACA
ACCCGCCGTCTATTCTCCGTCTATACCCTACATCGTACGACCTCGGCCACGGCATTACGATCCCCCTCGACTCGCAACCACTCCCCTTCTCATCTCCGCCAAACCCGAACCAAAGCAGAC
ATGTCTTCCGCAACTACCTTTTACGACTTTAAACCCCTGAACA
ACCGCGGCCAGGAGGTCCCCCTATCCGACTACAAAGGCAAGGTCGTCCTCATCGTCAACACGGCCTCCAAGTGCAGC
TTCACCCCGCAGTACGCCGGCCTCGAGTCGCTCTACAAGTCGATCCGCGAGAAGCGCGGCGAGGACTTTGCCATGCTCGGCTTCCCCTGCAACCAGTTCGGCGCCCAGGAGCCGGGCTCC
GACGAGGACATCCAGCAGTTCTGCCAGGTCAACTACGGCGTCTCCTTCCCCATGATGAAGAAGATCGACGTCAACGGCGACGCCGCCAGCCCGCTCTTCACGTGGCTCAAGGAGGAGAAG
CCCGGCATCATGGGCCTCAAGCGCGTCAAGTGGAACTTTGAAAAGTTCCTCGTCGGCCGCGACGGGAAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGAGCCTCGAGGCGGCT
ATCCTTGCCGAGCTCGATGCCAAGGCCGCCTAA

Retrieve as FASTA