Entry information : AcarGPx01
Entry ID 10067
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2016-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-10 (Achraf Jemmat)
Peroxidase information: AcarGPx01
Name AcarGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus carbonarius    [TaxId: 40993 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcarGPx01
start..stop
S start..stop
AnGPx 407 1e-145 1..250 1..261
NfGPx 345 2e-121 25..267 2..240
AfumGPx 337 2e-118 54..267 24..235
PEchGPx01 332 5e-117 74..261 1..188
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1963511..1963772 262 N° 2 1963850..1964391 542  
join(1963511..1963772,1963850..1964391)


exon

Literature and cross-references AcarGPx01
DNA ref. JGI genome:   scaffold_2 (1963511..1964391)
Cluster/Prediction ref. Genebank:   31395
Protein sequence: AcarGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268
PWM (Da):   %s   29290.2  
PI (pH):   %s   9.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSSIAFRDLSSCRSRLASQTAYLVAPPLVTVRSVSTTTTTVPATAIRLATSSHQTPRNIFPTIQRIHSLSTMSSATTFYDFEPVDKKGNAFPLTSLQGKVVLVVNTASKCGFTPQFQGLEKLYQDLKAKYPEDFTIIGFPCNQFGSQDPGSNDEIQSFCQINYGVTFPVLGKLDVNGDKAAPVWTWMKEQQPGLLGLKRIKWNFEKFLISADGKVVGRWASLTKPESLEEPILKELEKAKKEGTLASLKQAGEGEAQGEPEAKLA

Retrieve as FASTA  
Remarks Complete sequence from genomic(scaffold_2:1963730-1964343 (+), 1 intron) NO ESTS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTGTCATCCATCGCATTTCGTGATTTATCATCCTGCAGGTCGAGACTTGCGTCGCAAACTGCTTATCTAGTTGCGCCCCCCTTGGTGACGGTACGATCCGTTAGTACAACAACT
ACTACTGTTCCTGCTACTGCTATTCGTCTTGCGACATCCTCGCACCAGACCCCCCGGAACATTTTTCCTACCATCCAAAGGATTCATTCACTGTCAACCATGTCTTCCGCGACCACTTTC
TACGACTTCGAGCCCGTCGATA
GTACGTCATTTCCTTTTATCTCTCTTCCTGCATTTCCCCCCACCCAAGAGACTAACCATAACCCCTCCCATCAACAGAAAAGGGCAACGCCTTCCCCC
TCACCTCCCTGCAGGGCAAGGTCGTCCTGGTCGTCAACACGGCCTCGAAATGCGGTTTCACGCCCCAGTTCCAAGGCCTTGAGAAGCTCTACCAGGACTTGAAGGCCAAGTACCCCGAGG
ACTTCACCATCATCGGATTCCCCTGCAACCAGTTCGGAAGCCAGGACCCCGGCTCCAACGACGAGATCCAGTCGTTCTGCCAGATCAACTACGGAGTGACGTTCCCCGTGCTGGGCAAGT
TGGACGTGAATGGAGACAAGGCGGCGCCGGTGTGGACGTGGATGAAGGAACAGCAGCCCGGTCTGCTGGGCCTGAAGCGTATTAAGTGGAACTTTGAGAAGTTCTTGATCTCGGCTGATG
GAAAGGTTGTGGGACGTTGGGCGAGTTTGACGAAGCCGGAGTCGTTGGAGGAGCCCATTCTGAAGGAGCTTGAGAAGGCGAAGAAGGAGGGGACGTTGGCTTCGCTGAAGCAGGCGGGTG
AGGGTGAGGCCCAGGGTGAGCCCGAGGCGAAGCTTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTGTCATCCATCGCATTTCGTGATTTATCATCCTGCAGGTCGAGACTTGCGTCGCAAACTGCTTATCTAGTTGCGCCCCCCTTGGTGACGGTACGATCCGTTAGTACAACAACT
ACTACTGTTCCTGCTACTGCTATTCGTCTTGCGACATCCTCGCACCAGACCCCCCGGAACATTTTTCCTACCATCCAAAGGATTCATTCACTGTCAACCATGTCTTCCGCGACCACTTTC
TACGACTTCGAGCCCGTCGATA
AAAAGGGCAACGCCTTCCCCCTCACCTCCCTGCAGGGCAAGGTCGTCCTGGTCGTCAACACGGCCTCGAAATGCGGTTTCACGCCCCAGTTCCAAGGC
CTTGAGAAGCTCTACCAGGACTTGAAGGCCAAGTACCCCGAGGACTTCACCATCATCGGATTCCCCTGCAACCAGTTCGGAAGCCAGGACCCCGGCTCCAACGACGAGATCCAGTCGTTC
TGCCAGATCAACTACGGAGTGACGTTCCCCGTGCTGGGCAAGTTGGACGTGAATGGAGACAAGGCGGCGCCGGTGTGGACGTGGATGAAGGAACAGCAGCCCGGTCTGCTGGGCCTGAAG
CGTATTAAGTGGAACTTTGAGAAGTTCTTGATCTCGGCTGATGGAAAGGTTGTGGGACGTTGGGCGAGTTTGACGAAGCCGGAGTCGTTGGAGGAGCCCATTCTGAAGGAGCTTGAGAAG
GCGAAGAAGGAGGGGACGTTGGCTTCGCTGAAGCAGGCGGGTGAGGGTGAGGCCCAGGGTGAGCCCGAGGCGAAGCTTGCTTAA

Retrieve as FASTA