Entry information : BbotGPx01
Entry ID 10068
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2012-01-04 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: BbotGPx01
Name BbotGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Botryobasidiaceae Botryobasidium
Organism Botryobasidium botryosum    [TaxId: 264124 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BbotGPx01
start..stop
S start..stop
JargGPx01 249 6e-85 23..188 63..230
PcGPx 245 2e-84 31..188 2..159
PstrGPx01 248 3e-84 4..190 68..256
GtraGPx01 244 3e-83 32..188 64..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 390852..390962 111 N° 2 391025..391075 51 N° 3 391133..391161 29 N° 4 391221..391311 91
N° 5 391374..391415 42 N° 6 391483..391557 75 N° 7 391617..391676 60 N° 8 391741..391752 12
N° 9 391815..391841 27 N° 10 391899..391979 81  
join(390852..390962,391025..391075,391133..391161,391221..391311,391374..391415, 391483..391557,391617..391676,391741..391752,391815..391841,391899..391979)


exon

Literature and cross-references BbotGPx01
DNA ref. JGI genome:   scaffold_15 (390852..391979)
Protein sequence: BbotGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193
PWM (Da):   %s   21015.74  
PI (pH):   %s   9.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLRQATAAPLFLAARLSSSFLKTMSTEAKSSFYSLKAPTPTGEYEFSTLEGKVVLIVNTASKCGFTPQYKGLQDLHNKFKDQGLVVLGFPCNFGGQEPGTDADIGSFCELNHGVTFPLMKKSDVNGDNTSEVFKWLKAQKKGGILGMNRVSWNFEKFLVDQNGTLVNRYVSTTSPEKIGGDVQKLLETKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_15, 9 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTCCGTCAGGCAACAGCAGCACCCCTCTTTCTTGCTGCCCGTCTGTCGTCCAGCTTCCTGAAAACCATGTCTACCGAGGCAAAATCTTCGTTCTACAGCCTCAAGGTAAAGCGC
CTGTTCCGCAGGTGCTTTTGACGCGCAGGCGCTGATTTAGCAAGTGAGCGTAGGCCCCAACTCCTACTGGAGAGTACGAGTTCTCCACCTTGGAGGGCAAGGTGGTACGTAATGATGTCC
ACCGATTCGACGATGCGCAAAGGCTAACAGACATCTCAAAGGTTCTTATTGTTAACACGGCGTCGAAATGGTCTGCTCTTTGTTCTTCAATAAAAGATAGCGCTAGTAGGGGCTAAAGAT
ACGATGTAGTGGATTTACCCCACAATACAAAGGGCTCCAGGACCTTCACAACAAGTTTAAGGACCAAGGCCTCGTTGTTCTTGGTTTCCCTTGCAACCAAGTGAGATGGGAAACCTTCAT
TCATCGAGCTTTATTTGCTGACATACATTTCGGATTATGTAGTTTGGAGGACAGGAGCCAGGGACTGACGCTGACATTGGCTCGGTAAGCTTTCGTCCTCACAATCCTGGATCGCTGCGG
ACGCTCATACTCCTTTTTTTTGCTGGTATAGTTCTGCGAGCTTAACCACGGAGTCACGTTCCCGCTCATGAAGAAATCGGATGTGAACGGTGACAACACCAGCGAGGTCGGTTCAGCATG
CCACACTGGATAGGGCGCGCGAGCCGTTAATACGAATCATACCAGGTTTTCAAGTGGCTCAAGGCTCAGAAGAAGGGTGGAATTCTGGGTATGAACCGCGTTTCGGTGAGTAGCATTAAA
CTTTTCTCGCCGTGCTACTCATGACACTTGAGCGTTCGTCACTATGCAGTGGAATTTCGAGGTATGTTCCCTGCCTATTCTATTCTTCCTATTATTGTCAGTGCTTACTCTCTCATCAAA
CAGAAATTCTTGGTCGATCAGAACGGAACGGTATGCCTCATGAATACTTGCCAGCCTCAACTTTCGAATACTGATGTAGTCTTCTAGCTCGTCAACCGATACGTCTCGACCACATCTCCC
GAAAAAATTGGTGGAGATGTCCAGAAACTGTTGGAAACCAAGGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTCCGTCAGGCAACAGCAGCACCCCTCTTTCTTGCTGCCCGTCTGTCGTCCAGCTTCCTGAAAACCATGTCTACCGAGGCAAAATCTTCGTTCTACAGCCTCAAGGCCCCAACT
CCTACTGGAGAGTACGAGTTCTCCACCTTGGAGGGCAAGGTG
GTTCTTATTGTTAACACGGCGTCGAAATGTGGATTTACCCCACAATACAAAGGGCTCCAGGACCTTCACAACAAGTTT
AAGGACCAAGGCCTCGTTGTTCTTGGTTTCCCTTGCAACCAA
TTTGGAGGACAGGAGCCAGGGACTGACGCTGACATTGGCTCGTTCTGCGAGCTTAACCACGGAGTCACGTTCCCGCTC
ATGAAGAAATCGGATGTGAACGGTGACAACACCAGCGAG
GTTTTCAAGTGGCTCAAGGCTCAGAAGAAGGGTGGAATTCTGGGTATGAACCGCGTTTCGTGGAATTTCGAGAAATTCTTG
GTCGATCAGAACGGAACG
CTCGTCAACCGATACGTCTCGACCACATCTCCCGAAAAAATTGGTGGAGATGTCCAGAAACTGTTGGAAACCAAGGCCTGA

Retrieve as FASTA