Entry information : BdotGPx01
Entry ID 10069
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2016-03-10 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-10 (Achraf Jemmat)
Peroxidase information: BdotGPx01
Name BdotGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Botryosphaeria
Organism Botryosphaeria dothidea    [TaxId: 55169 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdotGPx01
start..stop
S start..stop
PnoGPx 308 2e-107 90..260 54..224
LpaluGPx01 308 4e-107 67..256 48..231
ClunGPx01 301 2e-105 91..259 1..169
Ssrc1lsm3aGPx01 300 4e-105 91..260 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34272..34534 263 N° 2 34904..35423 520  
join(34272..34534,34904..35423)


exon

Literature and cross-references BdotGPx01
DNA ref. JGI genome:   NODE_904_length_55372_cov_62.754730 (34492..35373)
Protein sequence: BdotGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   261
PWM (Da):   %s   28238.88  
PI (pH):   %s   10.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPALLRLVSRPTTAGHLPISIQAAVVAVATKGAVLRSPAVKSCSRRRPASSFVTPAVPRVAASTPLLPTTATTTLPDTQLLRHFHHSTHHTQRQRQS*HKPSHTEKGQPYDLASLKGKVILVVNTASKCGFTPQFGGLEALWKDVKTAHPDDFLILGFPCNQFGGQDPGSNDEIQSFCQVNYGVSFPVLGKVDVNGDSADPVWEWLKKEQPGLMGLKRVKWNFEKFLIGRDGKVKGRWASTTKPETLKETIEKELAAPKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGGCGCTATTGCGACTCGTTTCTCGTCCGACGACGGCGGGGCACTTGCCTATAAGCATCCAAGCTGCTGTCGTCGCCGTTGCTACAAAAGGCGCTGTTCTCCGATCGCCAGCAGTA
AAGTCTTGTTCTCGCCGTCGCCCCGCGTCTTCTTTCGTCACACCTGCTGTCCCTCGAGTAGCCGCATCAACCCCGCTGTTGCCGACTACCGCCACTACTACTCTCCCCGACACGCAACTT
CTCCGACACTTTCACCACTCAAC
AAGAACTATGGCCTCCGCAACGAGCTTCTACGATTTCAAGCCCCTCGATAGTGAGTCTACCCCGGAGCTCTGAGCCTTGCGCTGCGCAGTCCTCGGC
CTTCTCGAGCTGCCGCTGCGACGTGCGAGCGACGTCATCCCATCCAATCTTTCTCCACGCAAAACTCCCAGACACCACCCACGCGCGCTGCACGCCGTGTCTCAAACACCGTCATACAGC
AGGCGTCCGCACCTGTAACTGCCGCATCCACAGCACCCTAAACATGCCCCCTAGCGGCGCGACGGCGGGACCGTTTCCCAGGATCCTTCGGTCCCGTCGCCACCCAGCTTCCCACAGTCG
TCATCGCTCCACCACCACCACCACCACCACCACCACCACACACAAAGACAAAGACAAAGCTAACACAAACCCTCCCACACAGAGAAGGGGCAGCCCTACGACCTCGCCTCTCTCAAGGGC
AAAGTCATCCTCGTCGTCAACACGGCCAGCAAGTGCGGCTTCACGCCGCAGTTCGGCGGCCTCGAGGCGCTCTGGAAGGACGTCAAAACCGCGCACCCCGACGACTTCCTCATCCTCGGC
TTCCCGTGCAACCAGTTCGGCGGCCAGGACCCGGGCTCCAACGACGAGATCCAGTCGTTCTGCCAGGTCAACTACGGCGTCTCGTTCCCCGTGCTCGGCAAGGTCGACGTCAACGGCGAC
AGCGCCGACCCCGTGTGGGAGTGGCTGAAGAAGGAGCAGCCCGGCCTGATGGGCCTGAAGCGCGTCAAGTGGAACTTTGAGAAGTTCCTGATCGGCCGCGACGGCAAGGTCAAGGGCCGG
TGGGCCAGCACGACCAAGCCCGAGACCTTGAAGGAGACGATCGAGAAGGAGCTGGCCGCCCCCAAGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGGCGCTATTGCGACTCGTTTCTCGTCCGACGACGGCGGGGCACTTGCCTATAAGCATCCAAGCTGCTGTCGTCGCCGTTGCTACAAAAGGCGCTGTTCTCCGATCGCCAGCAGTA
AAGTCTTGTTCTCGCCGTCGCCCCGCGTCTTCTTTCGTCACACCTGCTGTCCCTCGAGTAGCCGCATCAACCCCGCTGTTGCCGACTACCGCCACTACTACTCTCCCCGACACGCAACTT
CTCCGACACTTTCACCACTCAAC
CCACCACACACAAAGACAAAGACAAAGCTAACACAAACCCTCCCACACAGAGAAGGGGCAGCCCTACGACCTCGCCTCTCTCAAGGGCAAAGTCATC
CTCGTCGTCAACACGGCCAGCAAGTGCGGCTTCACGCCGCAGTTCGGCGGCCTCGAGGCGCTCTGGAAGGACGTCAAAACCGCGCACCCCGACGACTTCCTCATCCTCGGCTTCCCGTGC
AACCAGTTCGGCGGCCAGGACCCGGGCTCCAACGACGAGATCCAGTCGTTCTGCCAGGTCAACTACGGCGTCTCGTTCCCCGTGCTCGGCAAGGTCGACGTCAACGGCGACAGCGCCGAC
CCCGTGTGGGAGTGGCTGAAGAAGGAGCAGCCCGGCCTGATGGGCCTGAAGCGCGTCAAGTGGAACTTTGAGAAGTTCCTGATCGGCCGCGACGGCAAGGTCAAGGGCCGGTGGGCCAGC
ACGACCAAGCCCGAGACCTTGAAGGAGACGATCGAGAAGGAGCTGGCCGCCCCCAAGGCTTGA

Retrieve as FASTA