Entry information : CputGPx01
Entry ID 10075
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2012-01-04 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: CputGPx01
Name CputGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coniophoraceae Coniophora
Organism Coniophora puteana    [TaxId: 80637 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CputGPx01
start..stop
S start..stop
SlacGPx01 272 8e-93 109..268 83..242
TvGPx01 270 8e-92 50..266 15..229
DqueGPx01 266 2e-91 109..266 2..159
GmarGPx02 266 1e-90 83..266 40..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1207591..1208018 428 N° 2 1207506..1207528 23 N° 3 1207157..1207398 242 N° 4 1206902..1207015 114
complement(join(1206902..1207015,1207157..1207398,1207506..1207528,1207591..1208 018))


exon

Literature and cross-references CputGPx01
DNA ref. JGI genome:   scaffold_3 (1208018..1206902)
Protein sequence: CputGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269
PWM (Da):   %s   29440.9  
PI (pH):   %s   10.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVFSTRSTCSRGFRRTTGALTVLLGPGTRACHSRNSQLRLSVAIVPPQQASASPARSHWSPPDHRNLSSRSTGSRVLSYTRQLRLSGQRASFSSSSSVPDNSSMSDKTSFYDLKAEQPGGKTFEFEQLKGKVVLVVNTASQCGFTPQYGLQELHDKYKDQGLVLLGFPCNQFGGQEPHADDKIAEFCTLNHGVSFPLMKKSDVNGDGTNEVFKWLKNEKAGIMGIQRIWNFEKFLVGKNGEVIQRWASTTTPQGLEPTIQQALAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_3:1206657-1208012 (-), 3 introns) NO EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGTGTTCTCGACCAGATCCACATGCTCAAGAGGCTTCCGTCGGACGACGGGTGCTCTAACAGTGCTCCTGGGACCGGGAACGCGAGCGTGCCATAGCCGTAATAGCCAGTTGAGG
CTGAGTGTCGCGATCGTACCACCCCAACAAGCATCGGCATCGCCAGCGCGGTCACACTGGTCGCCACCAGATCATCGTAATTTAAGCTCACGCTCGACGGGCTCTCGTGTTCTTTCTTAT
ACTCGGCAGCTGCGACTCTCTGGGCAACGCGCATCTTTTTCCTCTTCCTCCTCCGTACCCGATAATTCGAGCATGTCCGACAAGACCTCTTTCTACGATCTCAAGGCTGAGCAGCCCGGT
GGCAAGACGTTCGAGTTCGAGCAGCTCAAGGGCAAGGTCGTGTTGGTCGTCAACACCGCCAGCCAGTG
GTGCGTGGCTATCTCTCGCCGATAACGCTCTGCAGTTGCTCATTCTCGTCGT
GTATATGCAGTGGCTTCACCCCGCAGTACAAAGGTACGAGTCGTCCACACAGTCTCCTTTCCGCCGTCGCCGAGCACCACCATCTACCTCCACCCCACACTAAACCGAACCAAACCAAAC
TAACAATAAAATAAACACAGGCCTCCAAGAGCTGCACGACAAATACAAAGACCAGGGCCTCGTCCTGCTCGGCTTCCCGTGCAACCAGTTCGGCGGGCAGGAGCCGCACGCGGACGACAA
GATCGCCGAGTTCTGCACGCTCAACCACGGCGTCAGCTTCCCGCTCATGAAGAAGAGCGACGTGAACGGGGACGGCACCAACGAGGTGTTCAAGTGGCTCAAGAACGAGAAGGCGGGCAT
CATGGGCATCCAGCGGATCAAG
GTGCGTTATTGCGCGGGTTATTCAATGCAAGCTGCACCCTCTCTTTGCTTTGGTTCTCGTCGACGCTCTCTCCGCCTGTCTTCATTTTCTCCTTCTTT
TGTATGTTAGAAATAATGTAACTAACAAGACGATACCTTGCAGTGGAACTTCGAGAAATTCTTAGTGGGCAAGAACGGCGAGGTCATTCAACGCTGGGCGTCGACAACGACACCCCAGGG
TTTGGAGCCCACCATCCAGCAGGCACTCGCTGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGTGTTCTCGACCAGATCCACATGCTCAAGAGGCTTCCGTCGGACGACGGGTGCTCTAACAGTGCTCCTGGGACCGGGAACGCGAGCGTGCCATAGCCGTAATAGCCAGTTGAGG
CTGAGTGTCGCGATCGTACCACCCCAACAAGCATCGGCATCGCCAGCGCGGTCACACTGGTCGCCACCAGATCATCGTAATTTAAGCTCACGCTCGACGGGCTCTCGTGTTCTTTCTTAT
ACTCGGCAGCTGCGACTCTCTGGGCAACGCGCATCTTTTTCCTCTTCCTCCTCCGTACCCGATAATTCGAGCATGTCCGACAAGACCTCTTTCTACGATCTCAAGGCTGAGCAGCCCGGT
GGCAAGACGTTCGAGTTCGAGCAGCTCAAGGGCAAGGTCGTGTTGGTCGTCAACACCGCCAGCCAGTG
TGGCTTCACCCCGCAGTACAAAGGCCTCCAAGAGCTGCACGACAAATACAAA
GACCAGGGCCTCGTCCTGCTCGGCTTCCCGTGCAACCAGTTCGGCGGGCAGGAGCCGCACGCGGACGACAAGATCGCCGAGTTCTGCACGCTCAACCACGGCGTCAGCTTCCCGCTCATG
AAGAAGAGCGACGTGAACGGGGACGGCACCAACGAGGTGTTCAAGTGGCTCAAGAACGAGAAGGCGGGCATCATGGGCATCCAGCGGATCAAG
TGGAACTTCGAGAAATTCTTAGTGGGC
AAGAACGGCGAGGTCATTCAACGCTGGGCGTCGACAACGACACCCCAGGGTTTGGAGCCCACCATCCAGCAGGCACTCGCTGCTTAG

Retrieve as FASTA