Entry information : McirGPx01
Entry ID 10077
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: McirGPx01
Name McirGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Mucoraceae Mucor
Organism Mucor circinelloides    [TaxId: 36080 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value McirGPx01
start..stop
S start..stop
PblGPx02 257 1e-89 1..159 1..159
PblGPx01 233 2e-80 1..159 1..159
UramGPx01 225 4e-77 3..159 11..167
ScocGPx01 218 5e-74 3..159 13..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 491885..491959 75 N° 2 492017..492152 136 N° 3 492218..492293 76 N° 4 492353..492421 69
N° 5 492484..492511 28 N° 6 492570..492665 96  
join(491885..491959,492017..492152,492218..492293,492353..492421,492484..492511, 492570..492665)


exon

Literature and cross-references McirGPx01
DNA ref. JGI genome:   scaffold_09 (491885..492665)
Protein sequence: McirGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   17984.41  
PI (pH):   %s   8.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTIYDFKVKDIKNKEWDLADLKGKVVLFVNVASKCGFTKQYAGLEELYKKYEPKGFVIVGSPCNQFGGQEPGSEEEIQNFCTLTWSVTFPLTAKLDVNGDNEAPLYKFLKASQPGILGLKRVKWNFKFLVNREGKVVKRFASTTEPKSIADDIEKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_09:491861-492742 (+), 5 introns)77 ESTs. Strain "CBS277.49".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACTATCTACGATTTCAAGGTCAAGGACATCAAGAACAAGGAATGGGATCTCGCTGATCTCAAGGGAAAGGTAACTAAATTAAAGGGTGATATCTGTAATGCAAGGTGAATAACC
CCGTTTGCAAAGGTTGTTCTCTTTGTCAATGTCGCCTCCAAGTGTGGTTTCACCAAGCAATATGCTGGCTTGGAGGAGCTCTACAAAAAGTACGAACCCAAGGGTTTCGTTATCGTTGGT
TCTCCCTGTAACCAATTTGGTGGTCAAG
GTAAGTTTTGTCATTGGACATACCCCGCGTAGATTATACCTAATATGTGGATTTCCTGTTGATAGAGCCTGGATCCGAGGAAGAAATCCAAA
ACTTCTGTACTTTGACCTGGAGCGTCACCTTCCCTTTGACTGCAAAGCT
GTAAGTATGAGGCGATAAGGGGCTAAAGAACAAGCAATTTATGCGAGATGATTGTATAGTGATGTCAACGG
TGACAATGAAGCCCCTCTCTACAAGTTCTTGAAGGCATCTCAACCTGGTATTCTTGG
GTAAGTATACTGCGTATTCTTGATCTGTGGATCTACATGTACTAAACATCTCTTATCACCAGT
TTGAAGCGCGTCAAGTGGAACTTTGAG
GTAACTATTACCAGGATTGAGTGCGTATGGCGTCATTGACTGACCCTCTTTATAATAGAAATTCTTGGTCAACCGTGAGGGTAAGGTTGTTAA
GCGTTTTGCCTCCACCACTGAACCCAAGTCTATTGCCGATGACATTGAGAAGCTCTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACTATCTACGATTTCAAGGTCAAGGACATCAAGAACAAGGAATGGGATCTCGCTGATCTCAAGGGAAAGGTTGTTCTCTTTGTCAATGTCGCCTCCAAGTGTGGTTTCACCAAG
CAATATGCTGGCTTGGAGGAGCTCTACAAAAAGTACGAACCCAAGGGTTTCGTTATCGTTGGTTCTCCCTGTAACCAATTTGGTGGTCAAG
AGCCTGGATCCGAGGAAGAAATCCAAAAC
TTCTGTACTTTGACCTGGAGCGTCACCTTCCCTTTGACTGCAAAGCT
TGATGTCAACGGTGACAATGAAGCCCCTCTCTACAAGTTCTTGAAGGCATCTCAACCTGGTATTCTTGGTTTG
AAGCGCGTCAAGTGGAACTTTGAG
AAATTCTTGGTCAACCGTGAGGGTAAGGTTGTTAAGCGTTTTGCCTCCACCACTGAACCCAAGTCTATTGCCGATGACATTGAGAAGCTCTTGTAA

Retrieve as FASTA