Entry information : PpaPrx67
Entry ID 10078
Creation 2012-01-05 (Qiang LI)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang Li)
Peroxidase information: PpaPrx67
Name PpaPrx67
Class Class III peroxidase     [Orthogroup: Prx175]*
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx67
start..stop
S start..stop
PpaPrx42 290 5e-100 36..204 143..312
PpaPrx42 111 5e-30 17..75 17..75
PpaPrx04 197 3e-63 53..203 167..318
PpaPrx04 84 6e-20 2..75 9..81
CpapPrx[P]27 135 4e-40 27..204 47..235
MsPrx13 131 4e-39 64..203 2..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7697..7900 204 N° 2 6756..7166 411  
complement(join(6756..7166,7697..7900))


exon

Literature and cross-references PpaPrx67
DNA ref. Phytozome 12:   scaffold_1060 (7900..6756)
Protein sequence: PpaPrx67
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   204 (183)
PWM (Da):   %s   21879.07 (19825.9)  
PI (pH):   %s   7.93 (7.93) Peptide Signal:   %s   cut: 22 range:22-204
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSVLALLVASLAALSTTVQAQLVENFYRTSCPSAETVITSAVNSALNRRAASAAGVLRIHFHDCFVHTEEMVVLSGAHSVGVASCRAVQNRLTTPPDATLDPTYAQALQRQCPAGSPNNVNLDVTTPTRLDEVYFKNLQARKGLLTSDQVLHEDPETKPMVAKHTSQGVFNEAFKNAMRKMSDIGVLTGSAGEIRANCHRFNA*

Retrieve as FASTA  
Remarks Partial sequence from genomic (PS is missing). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCAGTTTTGGCGCTGCTTGTGGCGTCTCTTGCAGCTCTGAGCACGACGGTGCAGGCGCAGCTGGTGGAGAACTTTTACAGGACCAGCTGCCCCAGTGCCGAGACTGTCATCACC
TCGGCTGTGAATTCCGCGCTGAACAGGCGTGCAGCTTCTGCCGCGGGCGTTCTTCGCATCCACTTCCACGACTGCTTCGTCCAC
GTAAGTTGCATCCCATGATCACCTATCCATGAACTT
CTGCCCCTCGCGACATGCCGTCGCGTACATTGGAGGGCACAGTGTCCGTGGACCCTCACAGTGGCGCAATCACCGGCGCGCGTACGGCATTGTTGCTGCCTCGTGCATGCATGTGGTGTT
GCAGCGCATTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNCACCGAGGAGATGGTCGTGTTGTCGGGCGCGCACAGCGTCGGTGTGGCGTCGTGCCGTGCAGTCCAGAACCGTCTCACCACTCCCCCAGACGCCACCTTGGATCCCA
CGTACGCCCAGGCGTTGCAGAGGCAGTGCCCCGCAGGCAGCCCCAACAATGTGAACCTGGACGTCACCACCCCCACCAGGCTGGACGAGGTCTACTTCAAGAACCTGCAAGCGAGGAAGG
GGCTGCTCACGTCCGACCAGGTGCTGCACGAGGACCCCGAAACCAAGCCCATGGTTGCGAAGCACACCAGCCAGGGGGTGTTCAACGAGGCTTTTAAGAACGCGATGAGGAAGATGAGCG
ACATCGGCGTGCTGACTGGCAGTGCGGGCGAGATCCGGGCGAACTGCCACCGCTTCAACGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCAGTTTTGGCGCTGCTTGTGGCGTCTCTTGCAGCTCTGAGCACGACGGTGCAGGCGCAGCTGGTGGAGAACTTTTACAGGACCAGCTGCCCCAGTGCCGAGACTGTCATCACC
TCGGCTGTGAATTCCGCGCTGAACAGGCGTGCAGCTTCTGCCGCGGGCGTTCTTCGCATCCACTTCCACGACTGCTTCGTCCAC
ACCGAGGAGATGGTCGTGTTGTCGGGCGCGCACAGC
GTCGGTGTGGCGTCGTGCCGTGCAGTCCAGAACCGTCTCACCACTCCCCCAGACGCCACCTTGGATCCCACGTACGCCCAGGCGTTGCAGAGGCAGTGCCCCGCAGGCAGCCCCAACAAT
GTGAACCTGGACGTCACCACCCCCACCAGGCTGGACGAGGTCTACTTCAAGAACCTGCAAGCGAGGAAGGGGCTGCTCACGTCCGACCAGGTGCTGCACGAGGACCCCGAAACCAAGCCC
ATGGTTGCGAAGCACACCAGCCAGGGGGTGTTCAACGAGGCTTTTAAGAACGCGATGAGGAAGATGAGCGACATCGGCGTGCTGACTGGCAGTGCGGGCGAGATCCGGGCGAACTGCCAC
CGCTTCAACGCCTAG

Retrieve as FASTA