Entry information : NdisGPx01
Entry ID 10091
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-26 (Catherine Mathe (Scipio))
Peroxidase information: NdisGPx01
Name NdisGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora discreta    [TaxId: 29879 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NdisGPx01
start..stop
S start..stop
NtetGPx01_2509 340 3e-121 1..167 61..227
NcGPx01 339 6e-121 1..167 63..229
SmaGPx01 328 7e-117 1..167 58..224
StheGPx01 292 2e-102 1..167 71..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3139803..3139845 43 N° 2 3139280..3139740 461  
complement(join(3139280..3139740,3139803..3139845))


exon

Literature and cross-references NdisGPx01
DNA ref. JGI genome:   scaffold_1 (3139845..3139280)
Protein sequence: NdisGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18868.58  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATTFYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEKYPDDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMQKVEVNGDNASPLYEWMKNEKPGLMGLKRVKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELGE

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). NO EST available. Strain "FGSC 8579 mat A".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGCCACTACTTTCTACGACTTCAAGCCTCTCGACAGTAAGCCCTCACCTAGTCTCTCACCAATACAGCATCACCACCCAATACTAACCAACCCACAGAGAAGGGCTCCGAAC
TCCCCCTCTCCACTTACCAAGGCAAAGTTGTCCTCATCGTGAACGTCGCCTCCAAGTGCGGTTTCACGCCTCAATACGCCGGCCTGGAAAAGGTCTACAAGGAGATCAAGGAGAAGTACC
CGGACGATTTTGAGATCCTCGCCTTCCCTTGCAACCAGTTCGGCGGACAGGAGCCGGGTACCGAGGAGGAGATCCAATCGTTCTGCCAGCTCAACTATGGCGTTTCCTTCCCCATCATGC
AGAAGGTGGAAGTCAACGGCGATAACGCTTCTCCCCTCTATGAGTGGATGAAGAATGAGAAGCCTGGTCTGATGGGATTGAAGAGAGTCAAGTGGAACTTTGAAAAGTTCTTGATTGGAA
AGGATGGCAAGGTCAAGGGACGGTGGGCGAGCACTACGAAGCCGGAGAGTCTGAAGGAGGCTATTCTCAAGGAGTTGGGCGAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGCCACTACTTTCTACGACTTCAAGCCTCTCGACAAGAAGGGCTCCGAACTCCCCCTCTCCACTTACCAAGGCAAAGTTGTCCTCATCGTGAACGTCGCCTCCAAGTGCGGT
TTCACGCCTCAATACGCCGGCCTGGAAAAGGTCTACAAGGAGATCAAGGAGAAGTACCCGGACGATTTTGAGATCCTCGCCTTCCCTTGCAACCAGTTCGGCGGACAGGAGCCGGGTACC
GAGGAGGAGATCCAATCGTTCTGCCAGCTCAACTATGGCGTTTCCTTCCCCATCATGCAGAAGGTGGAAGTCAACGGCGATAACGCTTCTCCCCTCTATGAGTGGATGAAGAATGAGAAG
CCTGGTCTGATGGGATTGAAGAGAGTCAAGTGGAACTTTGAAAAGTTCTTGATTGGAAAGGATGGCAAGGTCAAGGGACGGTGGGCGAGCACTACGAAGCCGGAGAGTCTGAAGGAGGCT
ATTCTCAAGGAGTTGGGCGAATAG

Retrieve as FASTA