Entry information : OmaiGPx01
Entry ID 10092
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: OmaiGPx01
Name OmaiGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Myxotrichaceae Oidiodendron
Organism Oidiodendron maius    [TaxId: 78148 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OmaiGPx01
start..stop
S start..stop
AresGPx01 310 3e-110 1..172 1..172
AmacrGPx01 302 2e-106 1..172 53..224
CgraGPx01 295 1e-103 1..166 69..234
ChigGPx01 293 9e-103 1..167 73..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2018837..2018879 43 N° 2 2018641..2018775 135 N° 3 2018249..2018589 341  
complement(join(2018249..2018589,2018641..2018775,2018837..2018879))


exon

Literature and cross-references OmaiGPx01
DNA ref. JGI genome:   scaffold_2 (2018879..2018249)
Protein sequence: OmaiGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   19514.91  
PI (pH):   %s   8.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATTFYDFKPLDKKGEPVPLEEYKGKVVLVVNTASKCGFTPQYEGLEKLYKSLREKHGDDFQILGFPCNQFGSQEPGSNDDIQTFCQVNYGVSFPIMGKTDVNGDKANPLYEWMKVSKPGLLGMKMIKWNFEKFLIGRDGKVKERWASTTKPENLEKAILEELKKPKSEL

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_2:2018249-2018879 (-), 2 introns). Strain "Zn".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGCAACTACCTTCTACGATTTCAAGCCCCTAGACAGTACGCTTCTCTATTCCTCCATTTGTGCACAAGTCCAAATACTGAAGCAGCGGTGCAACAGAGAAGGGCGAACCCGT
ACCACTCGAGGAGTACAAGGGTAAGGTCGTTCTGGTCGTGAACACAGCATCGAAATGCGGATTCACCCCACAGTACGAAGGGCTTGAGAAGCTCTACAAGTCTCTCCGAGAAAAGCATG
G
TTCGTCTATCTGGCCCTCCACCTTCTTCAGGCGCGTCTAACGAGCTCCAGGTGATGACTTCCAAATCCTCGGCTTCCCGTGCAACCAATTCGGATCCCAGGAGCCTGGATCCAACGACGA
TATCCAGACCTTCTGCCAGGTGAACTACGGCGTTTCCTTCCCCATCATGGGCAAGACGGATGTCAACGGAGACAAAGCGAACCCACTATACGAATGGATGAAAGTGTCAAAGCCGGGACT
GTTAGGCATGAAGATGATTAAGTGGAATTTCGAGAAGTTCTTGATTGGTCGTGATGGCAAGGTCAAGGAGAGATGGGCCAGTACCACCAAGCCAGAGAACTTGGAGAAAGCAATCTTGGA
GGAGCTGAAGAAGCCGAAGAGTGAGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGCAACTACCTTCTACGATTTCAAGCCCCTAGACAAGAAGGGCGAACCCGTACCACTCGAGGAGTACAAGGGTAAGGTCGTTCTGGTCGTGAACACAGCATCGAAATGCGGA
TTCACCCCACAGTACGAAGGGCTTGAGAAGCTCTACAAGTCTCTCCGAGAAAAGCATG
GTGATGACTTCCAAATCCTCGGCTTCCCGTGCAACCAATTCGGATCCCAGGAGCCTGGATCC
AACGACGATATCCAGACCTTCTGCCAGGTGAACTACGGCGTTTCCTTCCCCATCATGGGCAAGACGGATGTCAACGGAGACAAAGCGAACCCACTATACGAATGGATGAAAGTGTCAAAG
CCGGGACTGTTAGGCATGAAGATGATTAAGTGGAATTTCGAGAAGTTCTTGATTGGTCGTGATGGCAAGGTCAAGGAGAGATGGGCCAGTACCACCAAGCCAGAGAACTTGGAGAAAGCA
ATCTTGGAGGAGCTGAAGAAGCCGAAGAGTGAGCTGTGA

Retrieve as FASTA