Entry information : RgraGPx01
Entry ID 10095
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: RgraGPx01
Name RgraGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3002]
Taxonomy Eukaryota Fungi Basidiomycota Rhodotorula
Organism Rhodotorula graminis    [TaxId: 29898 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RgraGPx01
start..stop
S start..stop
SrosGPx01 238 1e-81 1..157 31..193
CputGPx01 188 5e-61 1..157 105..268
AbauGPx 184 7e-61 5..157 2..161
TcamGPx 182 3e-60 5..155 2..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1214923..1214991 69 N° 2 1215136..1215179 44 N° 3 1215421..1215440 20 N° 4 1215515..1215582 68
N° 5 1215643..1215831 189 N° 6 1215905..1215988 84  
join(1214923..1214991,1215136..1215179,1215421..1215440,1215515..1215582,1215643 ..1215831,1215905..1215988)


exon

Literature and cross-references RgraGPx01
DNA ref. JGI genome:   scaffold_4 (1214923..1215988)
Protein sequence: RgraGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   17503.02  
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSAASFYELEAEKPKGDKIKFEDYKGKAVLIVNTATKFTGLELYQKYKDQGLVVLGFPSDQFGHNPEDDEGTESFCQRNHGVSFPLLKKSDVNGPATNPVFQFLKPRAKGLLGERINWNFSKFLISKNGEVLHRYAPTTKPDAIAKDIEKALAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) No EST. Strain="WP1"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGCCGCCTCCTTCTACGAGCTCGAGGCTGAGAAGCCCAAGGGCGACAAGATCAAGTTCGAGGTGAGTCGCACGGTTGCTCCTCGGCGGGAGAAGTGCTGGACCCGAGCAAGG
GGAGCCGCCGCGAGGAGACGAGGATGGCGGCTCCCTCTTCTTCGTCGGTCGAGCCGCGATGTGCAAGTACTGACTCGCTCTCGCGACCTGCAGGACTACAAGGGCAAGGCCGTCTTGATC
GTCAACACCGCCACCAA
GTGAGCCTTCTGATCCACCTCCTCTTCCGCCTCGTCGCTTCCTCCCGTCCGTCTTCCTTCCCTCGCGGTCCCTGACACCTTATATTCTACGACAATCGATGCG
GCTTCACATTTCATTGAGTATTTAGTCTCTCCGTCGTCCGACGAGCCGGTAGGAGCGCGAGCGCTTCTCGGCCGTCGTGCGACCTCTTTCCAGCCTCGTCGACAGCTACTGATACCCGCC
TTCTTCCTTCCCGCGCAGGTTCACCGGGCTCGAGGAGCGTGAGTCTCACCGTCACTGTGCCTGACTGGGTCGCGATTTGACCTCGTCCCCCTCCTTCCCCTCGTCCCTGCAGTCTACCAG
AAGTACAAGGACCAGGGTCTCGTCGTCCTCGGCTTCCCCTCGGACCAGTTCGGCCACCAG
GTGCGCTCCCCTCTCCCTGACTCTCGTCGACGTCGTGCCTGACGTGCCCTCGTCGCGCAG

AACCCCGAGGACGACGAGGGCACCGAGAGCTTCTGCCAGCGCAACCACGGCGTGTCCTTCCCGCTCCTCAAGAAGTCGGACGTGAACGGGCCGGCGACCAACCCCGTCTTCCAGTTTCTC
AAGCCTCGCGCCAAGGGTCTCCTCGGTGAGCGTATCAACTGGAACTTTTCAAAGTTTCTCATCTCAAAG
GTACGCCGGCCCTCCTCTCGTCGTTCCCGACCAGACACTCCTCAGGCGGTT
CTTGACGAGCTCCCGCCCGCAGAACGGCGAGGTCCTCCACCGCTACGCGCCAACGACCAAGCCCGACGCCATCGCGAAGGACATCGAGAAAGCGCTCGCCGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGCCGCCTCCTTCTACGAGCTCGAGGCTGAGAAGCCCAAGGGCGACAAGATCAAGTTCGAGGACTACAAGGGCAAGGCCGTCTTGATCGTCAACACCGCCACCAAGTTCACC
GGGCTCGAGGAGC
TCTACCAGAAGTACAAGGACCAGGGTCTCGTCGTCCTCGGCTTCCCCTCGGACCAGTTCGGCCACCAGAACCCCGAGGACGACGAGGGCACCGAGAGCTTCTGCCAG
CGCAACCACGGCGTGTCCTTCCCGCTCCTCAAGAAGTCGGACGTGAACGGGCCGGCGACCAACCCCGTCTTCCAGTTTCTCAAGCCTCGCGCCAAGGGTCTCCTCGGTGAGCGTATCAAC
TGGAACTTTTCAAAGTTTCTCATCTCAAAG
AACGGCGAGGTCCTCCACCGCTACGCGCCAACGACCAAGCCCGACGCCATCGCGAAGGACATCGAGAAAGCGCTCGCCGCCTGA

Retrieve as FASTA