Entry information : SAcoGPx01
Entry ID 10096
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-07-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: SAcoGPx01
Name SAcoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Saitoella
Organism Saitoella complicata    [TaxId: 5606 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SAcoGPx01
start..stop
S start..stop
CangGPx01 244 1e-83 1..163 65..226
CzmGPx 241 1e-82 1..163 38..201
MpopGPx01 240 4e-82 1..159 61..220
NdisGPx01 238 5e-82 1..163 1..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 270830..270951 122 N° 2 270652..270770 119 N° 3 270458..270600 143 N° 4 270299..270406 108
complement(join(270299..270406,270458..270600,270652..270770,270830..270951))


exon

Literature and cross-references SAcoGPx01
DNA ref. JGI genome:   scaffold_13 (270951..270299)
Cluster/Prediction ref. JGI gene:   30557
Protein sequence: SAcoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   18158.18  
PI (pH):   %s   5.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSAATFYDLPAPLDKKKQEFPLSDLKGKVVLVVNVASKCGFTPQYEGLEKIYQQYKDKDFAIIGFPCNQFGAQEPGSDEIQSFCQLNYGVSFPVLAKVDVNGSTSSPIYEWLKNQKSGFMGLTRIWNFEKFLIGKDGNVVERYSSLSKPESIAEDIEKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) No EST. Strain="NRRL Y-17804".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCCGCGACTTTCTACGATCTCCCCGCTCCTCTCGATAAGAAGAAGCAGGAGTTCCCTCTCTCTGATTTGAAGGGAAAGGTCGTGTTGGTTGTGAATGTTGCAAGCAAGTGC
GG
GTATGACATATTGGGCGTATTATTCAGCCAGGACAGTGTCGCTGACGCACGTCGTACAGGTTCACCCCGCAATATGAAGGTCTCGAGAAGATCTACCAGCAGTACAAGGACAAGGATT
TCGCTATCATTGGATTCCCTTGTAACCAGTTCGGTGCTCAGGAGCCCGGAAGCGATGAGG
GTTTGTTCTTCTTCGTCGTCCGTCGTGCCTGTCAGCTGACAATGCTCGCAGAGATCCAAT
CCTTCTGTCAATTGAACTACGGCGTTTCCTTCCCCGTTCTCGCCAAGGTCGACGTTAACGGCTCTACATCGTCTCCTATCTACGAGTGGTTGAAGAACCAGAAGTCTGGTTTCATGGGTT
TGACTAGGATTAAG
ATGAGTACCCCTTCCTCTGCAGACGTGAACGTCGGCTAACAGCATGTTTACTGGAACTTCGAGAAGTTCTTGATTGGTAAGGACGGAAATGTTGTCGAGCGTTACT
CTTCGTTGTCGAAGCCCGAGAGCATCGCGGAAGATATTGAGAAGTTGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCCGCGACTTTCTACGATCTCCCCGCTCCTCTCGATAAGAAGAAGCAGGAGTTCCCTCTCTCTGATTTGAAGGGAAAGGTCGTGTTGGTTGTGAATGTTGCAAGCAAGTGC
GG
GTTCACCCCGCAATATGAAGGTCTCGAGAAGATCTACCAGCAGTACAAGGACAAGGATTTCGCTATCATTGGATTCCCTTGTAACCAGTTCGGTGCTCAGGAGCCCGGAAGCGATGAG
G
AGATCCAATCCTTCTGTCAATTGAACTACGGCGTTTCCTTCCCCGTTCTCGCCAAGGTCGACGTTAACGGCTCTACATCGTCTCCTATCTACGAGTGGTTGAAGAACCAGAAGTCTGGT
TTCATGGGTTTGACTAGGATTAAG
TGGAACTTCGAGAAGTTCTTGATTGGTAAGGACGGAAATGTTGTCGAGCGTTACTCTTCGTTGTCGAAGCCCGAGAGCATCGCGGAAGATATTGAG
AAGTTGCTTTAA

Retrieve as FASTA