Entry information : AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Entry ID 101
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Name (synonym) AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Mixed tissues
Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx20
start..stop
S start..stop
AhalPrx14 667 0 1..336 1..336
AlyPrx20 653 0 1..336 1..336
CrubPrx116 645 0 1..336 1..337
BstrPrx55 642 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14892636..14892860 225 N° 2 14893070..14893261 192 N° 3 14893365..14893958 594  
join(14892636..14892860,14893070..14893261,14893365..14893958)


exon

Literature and cross-references AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Protein ref. UniProtKB:   Q9SLH7
DNA ref. Phytozome 12:   Chr2 (14892636..14893958)
mRNA ref. GenBank:   NM_129090.3
Cluster/Prediction ref. Phytozome Gene 12:   19643048 UniGene:   At.89
Omic ref. AtProteome:   At2g35380 ATTED-II:   At2g35380 e-FP Browser:   At2g35380 ePlant:   At2g35380 Genevestigator:   At2g35380 TAIR:   At2g35380
Protein sequence: AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (312)
PWM (Da):   %s   37840.37 (35125.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   5.11 (4.88) Peptide Signal:   %s   cut: 25 range:25-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIKQKKVWLSLIVLYAITTSVLGDFGEPLLKGFYKESCPLAEEIVKHNIEVAVLKDPRMAASLLRLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNLNSLRGFEVIDYIKYLLEEACPLTVSCSDILALAARDSVFLRGGPWWEVLLGRRDSLKASFAGANQFIPAPNSSLDSLIINFKQQGLNIQDLIALSGAHTIGKARCVSFKQRIVQPNMEQTFYVDEFRRHSTFRRVLGSQCKDSSRDNELSPLDIKTPAYFDNHYFINLLEGRGLLISDNVLVSEDHEGEIFQKVWEYAVNQDLFFIDFVESMLKMGNINVLTGIEGEIRENCRFVNI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1 and 2), 5 cDNA and 7 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAGGAATTC ACTTAGAGAG ATAAAGAAGA AGAAAATTCT TTACTTTGAT ATGAGACGCC ACTCGAATTT GAGACGGCCG AGCTGGGCCG ATGGTTTTGT ACGTGATCTC GACGGTGCCA  TTGTTGGTTG AATCTGAGCT CAGCTCTTCG GTTGAATTCA TCATCTCACC ACGAATTGTA TGCAATCAAT GAGAAATTGA GGATTAGGGT TTCGAATTTG GGAATTGAAA AAAACAGAGT  TTGTTTTCTC ACTTGCTACT TCTCCGATGA CGGAGAGTCG ACTTGAGTTT TCAATATTTT CATATCTGTC CTTACATATG TTTTTAATTC CACTTTTAAC CCCAAAGGTT TCAGAGAGTA  TAAAAAACTC CAAAACATTG GAAAAGCAAT TGTAAGAGCT TCTGCGTCAA AAAGAAGGTT TGGGTTACAC TTTTCATACA CACCATATGC ATAGGATGAG GCCTTCAATT TCTGCCTTAC  ATATCAAAAG ATAGAACACA CACACAAATA AAGCAAAGAA ACAGAATATC TTTGAGATCT CCTCTTTATT TGGAGAAGAC AAAACACAGA ACAAGAATTA GAAAGAAGGG AGAGAAAGCA  AAAATGGCAC TAAGAATGTG GGCTTCTTCT ACAGCAAACG CTCTCAAGCT TTCTTCTTCT GTTTCCAAGT CTCATCTCTC TCCTTTCTCC TTCTCTAGAT GCTTCTCCAC AGGTGTTTGT  AATTGTGTAT GTAGTTGTGT GTGCATAGCT TTATCTGAAA CTGTTGATGA ATGTCTCTGT TATTTTTTTA GTTTTGGAGG GTTTGAAGTA TGCAAATTCA CATGAGTGGG TTAAACATGA  AGGCTCTGTT GCCACCATTG GCATCACTGC CCATGCTCAG GTTCTTATTT TTGTAATCTA AGTGTTAAAA TAGCTCAGAA ACTAGATAGA TGTCTCTTTG GACTTTTGGA GAATGGTTAT  AAAGATAATG ATAGTTTTGT AAGATTATTG GCTGAAATGG GAGGAGAAAT GACATTGATG TTGCAGGACC ATTTAGGTGA AGTGGTGTTT GTTGAACTGC CAGAGGACAA TACTTCAGTG  AGCAAAGAGA AAAGCTTTGG AGCAGTGGAG AGTGTGAAGG CAACAAGTGA GATCTTATCA CCAATCTCAG GTGAAATCAT TGAGGTTAAC AAGAAGCTCA CAGAATCACC TGGCTTGGTA  CAGTTTTAAA GTCTTAAGGA AATTAAGTAA GTTACCACTC ATGTGACAAC ATATAAGCAA TGATTTGGCA ATTGTGTGTT GTTTAGATCA ACTCAAGCCC CTATGAAGAT GGTTGGATGA  TCAAAGTGAA ACCAAGTAGC CCCGCGGAGT TGGAATCTTT GATGGGTCCA AAGGAATACA CCAAGTTCTG CGAGGAGGAA GATGCTGCTC ACTAGGAGGG TTTCTCTCTG TCTTTTATGT  TCCAAGTTCT ATCAATTCTC ATGCTTGTTT TCTAAATTTG CATACACTCT ATGACCAACT TCACAAAATA AGAGTTCAAG AAGATGAAAC AGAGACCTAA CAAACACATT AAGATTTTTT  CTTTCATATA TCTTGTTATC CTCAAAATGC ATTTACCATC ACCCCAAAAG CCAGTCCAAT AAAAAAGGTG ATCCTAATCA AAAATTATTA ATAAAAATTT GGTAACCTTA AAGATATAAC  CATTACTTTA AAATAAATAA TTGGTCATAA GAAAAGAAAC TGGTCGTCCA AATATTACAA TCTGCTCCAT TATATTGAAA TCACGTATTC AAGCTCATAA GGCAAGTTAG GTCCCTATTG  GTCAATTTGG TTGTATCTAC CGTTGACAAA ACTGTAACAT CCATTGTGGT AAAAATTGGG CATGAAAACA AACATAACGA CATATGATAA CATACAAGGA ACATAATATT AACGAAGCAC 
ACACATGACA CGTATATATA TATTCATATG CACACAAACA CAGATAGAGA TGAACAGAAA CACATGACAT AACTTTCCAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATCAAACAT CAATCAATAC AAATTGTTTG CACTTCTTTT GGTCTTCCAA TAAGGCATCA ACTTCACAAA ACTCATTACA ACTTCGATAA GTTCCATTAT TTTCTCCATT ATAACAATGT  CCAATTAAGT ATGATACAGG TCTGTTTGTT GGAATTGTTT CTGCTTAAGG CAAGTGAATT GTCAAAATAA TCTCAGCTTG TCATCTAAGC TGACAATTGA TAACTCCAAT TATTGAAGGA  CTCTGTTTTG TTCCGAAGTA AAATATCCAA ATATTTCAAG GCATCAGTAG AAAACCTTTG AGAATTGTTT TTGCATTTAA AGTGAATAGA ACTGTGAACA AGTCAAATTA ATTAGTCAAG  TGATTTCCAT TATGCACAAC TAGTAAAAAA ACAAAAAAAA ACATTCGGTA TATTTTCTGG GCATCAGATA ATCATAAAAG TTAGCATCAC ATAGAATCAG ACGCAAATTA CCCATGAAAT  ATAATTTCAT CATATGCCCA GTAGAAAACA AAGAGAATCA AAAACCAAAT CCTTAAAATC GACAAGACAT TCGAATTGTA CAAAAACATA AAAGAGACTA TGAATCTGAG TATCAGTTCT  CCAAGGTGAA TAAAACATCA ATGTAATTTC AGTAGTAAAT AACATCAATA TATGAGATTC ATCCTATACT CAGATTCAAA AGAAAACGAT TTTTTTAAGG ATACAAAAAC GAAATATTAA  AATTGAAAAC AAGATTTTAA GGATTTTTAT TGTAGAGTCG ATCAGAACCT GTCGAGAACA CAATTACATC ACATATATCA GTGGATTGAC AGACCTGTGA ATTTCTATCG TCACCTCGAC  TCATAAAAGT CCTTAAAAGA GTTTTTACAA AAATCCAAAA AAAACATGAA TTGAGGAAGA GATTAAGATC TAGAAAAGCT CAGAACTTCT TAGAGGGTTG TGTATTACCG TCAGCGATGG 
ATTAACCATC TCTGGCACAC GATTTTTTCC TCACAGCTCT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAAGCAGAAGAAAGTATGGCTTTCTTTAATTGTGCTTTATGCAATTACGACATCAGTTTTGGGGGACTTTGGAGAACCATTACTGAAGGGTTTCTACAAAGAGAGTTGCCCA
TTGGCAGAGGAAATCGTGAAGCATAACATCGAAGTTGCTGTTCTCAAAGATCCTCGTATGGCGGCTTCTCTTCTTCGTCTTCAGTTCCACGATTGCTTCGTCTTG
GTCAGAAAATCATCC
CTCTCTACTCTTTTAACTTCCTCATTTGTGAGGTTTTATAATTGTTCTCTCCGAGATGATAACTTTATCAAGTATTTTTGAGGCTCTAATTCTAGCATACTTCTTGAACGTTATTCGAAA
TTTGCGTGTATGAGAGTGAGACTGTCTTATTGCGTCTATGTGATGTTCAGTTGCGGGATTTATTGTGGGTTTAGGGTTGTGATGCGTCTGTGCTCTTGGACACACATGGAGATATGTTGA
GTGAGAAACAAGCAACTCCAAATCTGAACTCTTTACGTGGATTTGAAGTAATCGATTACATTAAGTACCTCCTCGAAGAAGCTTGTCCTCTAACTGTCTCATGTTCCGATATCCTTGCCT
TGGCCGCTCGTGACTCAGTCTTCCTG
GTAATTTCCCCCTTGCACTTTACTTCCTTAAGGCTCTTTCTGTTTAAATCGAAACCTATGTGGTCAGTTTCATTTAAACACAAATATTGTTTGG
TATCATCAGAGAGGTGGCCCATGGTGGGAAGTTTTGCTAGGGAGAAGAGACTCATTAAAGGCAAGTTTCGCCGGAGCAAACCAATTCATTCCAGCACCAAACTCCTCTCTCGACAGCCTC
ATCATCAATTTCAAGCAACAAGGGCTCAACATTCAAGATCTCATCGCTCTTTCGGGTGCTCATACAATAGGTAAAGCGAGATGCGTGAGCTTCAAGCAACGCATTGTTCAACCAAACATG
GAACAAACGTTCTACGTCGATGAGTTCAGAAGACACAGCACGTTCCGTCGAGTCCTAGGGTCACAATGCAAAGATTCAAGCCGAGACAACGAACTGTCTCCACTGGATATTAAGACACCA
GCTTACTTCGATAACCATTATTTCATCAATCTGTTAGAAGGGAGAGGGTTGTTGATTTCGGATAACGTTCTGGTCTCAGAAGATCATGAAGGAGAGATCTTTCAGAAAGTTTGGGAATAT
GCAGTTAATCAAGATCTTTTCTTCATAGATTTTGTGGAATCTATGTTAAAAATGGGTAATATTAATGTTCTTACAGGTATTGAAGGTGAAATTAGGGAGAATTGTAGATTTGTCAATATC
TGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAAGCAGAAGAAAGTATGGCTTTCTTTAATTGTGCTTTATGCAATTACGACATCAGTTTTGGGGGACTTTGGAGAACCATTACTGAAGGGTTTCTACAAAGAGAGTTGCCCA
TTGGCAGAGGAAATCGTGAAGCATAACATCGAAGTTGCTGTTCTCAAAGATCCTCGTATGGCGGCTTCTCTTCTTCGTCTTCAGTTCCACGATTGCTTCGTCTTG
GGTTGTGATGCGTCT
GTGCTCTTGGACACACATGGAGATATGTTGAGTGAGAAACAAGCAACTCCAAATCTGAACTCTTTACGTGGATTTGAAGTAATCGATTACATTAAGTACCTCCTCGAAGAAGCTTGTCCT
CTAACTGTCTCATGTTCCGATATCCTTGCCTTGGCCGCTCGTGACTCAGTCTTCCTG
AGAGGTGGCCCATGGTGGGAAGTTTTGCTAGGGAGAAGAGACTCATTAAAGGCAAGTTTCGCC
GGAGCAAACCAATTCATTCCAGCACCAAACTCCTCTCTCGACAGCCTCATCATCAATTTCAAGCAACAAGGGCTCAACATTCAAGATCTCATCGCTCTTTCGGGTGCTCATACAATAGGT
AAAGCGAGATGCGTGAGCTTCAAGCAACGCATTGTTCAACCAAACATGGAACAAACGTTCTACGTCGATGAGTTCAGAAGACACAGCACGTTCCGTCGAGTCCTAGGGTCACAATGCAAA
GATTCAAGCCGAGACAACGAACTGTCTCCACTGGATATTAAGACACCAGCTTACTTCGATAACCATTATTTCATCAATCTGTTAGAAGGGAGAGGGTTGTTGATTTCGGATAACGTTCTG
GTCTCAGAAGATCATGAAGGAGAGATCTTTCAGAAAGTTTGGGAATATGCAGTTAATCAAGATCTTTTCTTCATAGATTTTGTGGAATCTATGTTAAAAATGGGTAATATTAATGTTCTT
ACAGGTATTGAAGGTGAAATTAGGGAGAATTGTAGATTTGTCAATATCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGAGATGAAC AGAAACACAT GACATAACTT TCCAAATGGA GATCAAGCAG AAGAAAGTAT GGCTTTCTTT AATTGTGCTT TATGCAATTA CGACATCAGT TTTGGGGGAC TTTGGAGAAC  CATTACTGAA GGGTTTCTAC AAAGAGAGTT GCCCATTGGC AGAGGAAATC GTGAAGCATA ACATCGAAGT TGCTGTTCTC AAAGATCCTC GTATGGCGGC TTCTCTTCTT CGTCTTCAGT  TCCACGATTG CTTCGTCTTG GGTTGTGATG CGTCTGTGCT CTTGGACACA CATGGAGATA TGTTGAGTGA GAAACAAGCA ACTCCAAATC TGAACTCTTT ACGTGGATTT GAAGTAATCG  ATTACATTAA GTACCTCCTC GAAGAAGCTT GTCCTCTAAC TGTCTCATGT TCCGATATCC TTGCCTTGGC CGCTCGTGAC TCAGTCTTCC TGAGAGGTGG CCCATGGTGG GAAGTTTTGC  TAGGGAGAAG AGACTCATTA AAGGCAAGTT TCGCCGGAGC AAACCAATTC ATTCCAGCAC CAAACTCCTC TCTCGACAGC CTCATCATCA ATTTCAAGCA ACAAGGGCTC AACATTCAAG  ATCTCATCGC TCTTTCGGGT GCTCATACAA TAGGTAAAGC GAGATGCGTG AGCTTCAAGC AACGCATTGT TCAACCAAAC ATGGAACAAA CGTTCTACGT CGATGAGTTC AGAAGACACA  GCACGTTCCG TCGAGTCCTA GGGTCACAAT GCAAAGATTC AAGCCGAGAC AACGAACTGT CTCCACTGGA TATTAAGACA CCAGCTTACT TCGATAACCA TTATTTCATC AATCTGTTAG  AAGGGAGAGG GTTGTTGATT TCGGATAACG TTCTGGTCTC AGAAGATCAT GAAGGAGAGA TCTTTCAGAA AGTTTGGGAA TATGCAGTTA ATCAAGATCT TTTCTTCATA GATTTTGTGG  AATCTATGTT AAAAATGGGT AATATTAATG TTCTTACAGG TATTGAAGGT GAAATTAGGG AGAATTGTAG ATTTGTCAAT ATCTGAAATC AAACATCAAT CAATACAAAT TGTTTGCACT 

Retrieve as FASTA