Entry information : ZmPrx99 (GRMZM2G171078)
Entry ID 1010
Creation 2009-01-09 (Christophe Dunand)
Last sequence changes 2011-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx99 (GRMZM2G171078)
Name (synonym) ZmPrx99 (GRMZM2G171078)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx99
start..stop
S start..stop
SiPrx111 573 0 26..332 28..331
SbPrx105 569 0 1..332 1..328
SiPrx54 559 0 8..332 2..321
ZmPrx115 558 0 3..332 31..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 100126094..100126333 240 N° 2 100125800..100125991 192 N° 3 100125548..100125713 166 N° 4 100124328..100124728 401
complement(join(100124328..100124728,100125548..100125713,100125800..100125991,1 00126094..100126333))


exon

Literature and cross-references ZmPrx99 (GRMZM2G171078)
Literature Singh,J.A. et al., unpublished.
Cluster/Prediction ref. UniGene:   Zm.97895
Protein sequence: ZmPrx99 (GRMZM2G171078)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (299)
PWM (Da):   %s   34505.21 (31579.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.95 (7.70) Peptide Signal:   %s   cut: 34 range:34-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASAAAATRLSGGGVALLLLALLAAGTSTSSAQLSTGFYSHSCPGVHDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDTPSFQGEKMAKPNNGSVRGFEVIDAIKSAVDKACPGVVSCADILAIAARDSVVTLGGPNWDVKLGRRDSRTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHVYNDTNIDGAFARARRSVCPAAASSGSGGDNNLAPLDLQTPTVFENDYYRNLVCRKGLLHSDQELFNGAATDAQVQAYVSSQSAFFADFVAGMVKMGDISPLTGSSGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns) and 5 ESTs. Incorrect prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCATCAGCAGCAGCAGCCACGAGACTCAGCGGCGGCGGCGTCGCCCTCTTGCTCCTGGCGCTGCTGGCCGCCGGCACCTCCACCTCGTCGGCGCAGCTCTCCACCGGATTCTAC
TCGCACTCGTGCCCCGGCGTGCACGACGCCGTCAGGTCGGTGCTGCAGGCCGCCATCGCCAGGGAGCAGCGCATGGGAGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GCACGTATATATATTAACGGTCTCCACCATTATATATATATATTAGTTGCTTAACATGTATGTAATGACGATCATGCATGTTATCATGTGTATGTAATGCAGGGCTGCGACGCGTCGTTG
CTGCTGGACGACACGCCCAGCTTCCAGGGCGAGAAGATGGCCAAGCCTAACAACGGCTCCGTCAGAGGCTTCGAGGTCATCGACGCCATCAAGTCCGCCGTCGACAAGGCCTGCCCCGGG
GTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACAGCGTTGTCACC
GTAAGCTCTAGCTAGTAGCGAACACGGCTTCAATCTCTCACACGTACTACACACATCTAAATACTA
CCACACGCAAACACTTGCAGCTCGGAGGTCCGAACTGGGACGTCAAGCTTGGCCGGAGGGACTCCAGGACGGCGAGCTTCAGCGGCGCCAACAACAACATCCCGCCGCCCACGTCTGGCC
TCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGGTCTCTCCCAGAAAGACATGGTTGCACTCTCCG
GTGCGTGATGCATGATGATCATATTCACTGCATGCATTCATTCTAAATGCCATG
TTTTCCAAACAAAAAAACATTCTCAACAACTACGTACTAGGAGGCGTATTAATTAAAAATATAATAAGAGTATTATCACCACCGGAATTGATAGCTCCATTTTTGACTTGGGAGCAGCAG
AACTCTCTTCATAATATAATAATCAAGCTGTGCATGACATGAATATATGGCCTAATTTTGTCGGTTACCGACAAACACTATATATATATATATATATATATATGTATATATATGTCCGAT
ATTATTCATTACTACTAAAGAAGACACTCATAATCTTACATGAAAGTTGGTATGCCTCAAGTTTTTTACTTTTACAACATGCACATTGTCGGCAATGGCTCCCTTGAAGAAAGAATTTTG
TCCAAAAGCTTCATCAGTTTTGTAATCCTGATTATTGTAAATTAAAAGTAGCAGCTTTAATGAACTGTCTGATGGCTGAAAGACCACCATCAGTCTCTTCCACCAGATATCTTAATTCTG
TGGAATACAATGTGAAAGCAAGCGTATCTATAAAGTAGTAGGTCTGGCCACGTTATACGTACGTGTATATATATAATACAAGTTAGGTACAGACCACATACATGTGGTTCCTAATATACT
GTCTAGAACCGATACATTTTTTTAGAGAGAATCAAAAGAACAGCCTGTAATATATACGTTTTTAAAAACAAGACACTTTATTAAAAACTAAGCAATATATTAAATATTCCCACGCATGTG
TGCGTTGCTCTAATTTAATTTGGCACTCTCGATCTTCTTCTGCAGGAGCTCACACCATCGGCCAAGCACGCTGCACCAACTTCAGAGCGCACGTGTACAACGACACCAACATCGACGGCG
CCTTCGCGAGAGCAAGGCGATCGGTGTGCCCGGCAGCAGCCTCATCAGGCTCAGGCGGCGACAACAACCTGGCGCCTCTGGACCTCCAGACCCCGACCGTCTTCGAGAACGACTACTACA
GGAACCTTGTCTGCAGGAAGGGGCTCCTGCACTCCGACCAGGAGCTCTTCAATGGCGCGGCCACCGACGCGCAGGTCCAGGCGTACGTCAGCAGCCAGAGCGCGTTCTTCGCGGACTTCG
TGGCTGGCATGGTCAAGATGGGCGACATCTCGCCGCTCACGGGCTCCAGCGGGGAGATCAGGAAGAACTGCAGAAGGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCATCAGCAGCAGCAGCCACGAGACTCAGCGGCGGCGGCGTCGCCCTCTTGCTCCTGGCGCTGCTGGCCGCCGGCACCTCCACCTCGTCGGCGCAGCTCTCCACCGGATTCTAC
TCGCACTCGTGCCCCGGCGTGCACGACGCCGTCAGGTCGGTGCTGCAGGCCGCCATCGCCAGGGAGCAGCGCATGGGAGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GGCTGCGACGCGTCGTTGCTGCTGGACGACACGCCCAGCTTCCAGGGCGAGAAGATGGCCAAGCCTAACAACGGCTCCGTCAGAGGCTTCGAGGTCATCGACGCCATCAAGTCCGCCGTC
GACAAGGCCTGCCCCGGGGTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACAGCGTTGTCACC
CTCGGAGGTCCGAACTGGGACGTCAAGCTTGGCCGGAGGGACTCCAGG
ACGGCGAGCTTCAGCGGCGCCAACAACAACATCCCGCCGCCCACGTCTGGCCTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGGTCTCTCCCAGAAAGACATGGTTGCACTCTCCG
GA
GCTCACACCATCGGCCAAGCACGCTGCACCAACTTCAGAGCGCACGTGTACAACGACACCAACATCGACGGCGCCTTCGCGAGAGCAAGGCGATCGGTGTGCCCGGCAGCAGCCTCATCA
GGCTCAGGCGGCGACAACAACCTGGCGCCTCTGGACCTCCAGACCCCGACCGTCTTCGAGAACGACTACTACAGGAACCTTGTCTGCAGGAAGGGGCTCCTGCACTCCGACCAGGAGCTC
TTCAATGGCGCGGCCACCGACGCGCAGGTCCAGGCGTACGTCAGCAGCCAGAGCGCGTTCTTCGCGGACTTCGTGGCTGGCATGGTCAAGATGGGCGACATCTCGCCGCTCACGGGCTCC
AGCGGGGAGATCAGGAAGAACTGCAGAAGGATCAATTAA

Retrieve as FASTA