Entry information : WanoGPx01
Entry ID 10103
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-27 (Catherine Mathe (Scipio))
Peroxidase information: WanoGPx01
Name WanoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Ascomycota Saccharomycetes Wickerhamomycetaceae Wickerhamomyces
Organism Wickerhamomyces anomalus (Pichian anomal)    [TaxId: 4927 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WanoGPx01
start..stop
S start..stop
SpasGPx02 155 2e-49 13..154 3..144
PcarGPx01 151 5e-48 9..154 2..147
SpomGPx01 150 1e-47 13..154 3..143
CcasGPx01 149 4e-47 13..156 3..146
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 479629..479657 29 N° 2 479080..479511 432 N° 3 479038..479053 16  
complement(join(479038..479053,479080..479511,479629..479657))


exon

Literature and cross-references WanoGPx01
DNA ref. JGI genome:   scaffold_3 (479657..479038)
Protein sequence: WanoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   18666.45  
PI (pH):   %s   9.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPIMQQSTDVVNFHDLYTFDCDDNPIYFHSFIGKIVLVANVATQCASAYQLRQLEALYQKYKDRDFVVLAFPSNQFHQEKRGTNQEVADNCRKRFDVSFPIMEKVKVNGKNQSEVFRFLKENKHGFLNTKRVKWNFEKFLVDRDGTILKRYSTQRFA

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_3:479038-479657, 2 introns) No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCCAATAATGCAACAATCAACAGAGTCAGAGAAAACATTGGTCAGTGAAACTGGAAGTAGCCATGGAAGTTCACAGGATGTCATATCTTTATTACCAGAAATAACTGAAAAAGTG
ATTCAAGAAGAGACTGATACCAAAAGTGTTGTCAATTTCCATGACCTATACACATTTGATTGTGATGATAATCCAATATATTTCCATTCATTTATTGGGAAAATAGTGCTGGTCGCCAAT
GTTGCTACACAATGTGCCTCTGCTTATCAACTTCGACAACTAGAAGCCCTATATCAAAAATATAAAGATAGAGACTTTGTGGTGTTAGCATTCCCTTCTAATCAGTTTCATCAAGAAAAG
AGAGGAACCAATCAAGAAGTTGCTGACAATTGTCGAAAAAGGTTTGACGTATCATTCCCAATAATGGAGAAAGTTAAAGTGAATGGAAAGAACCAAAGTGAAGTATTTAGGTTTTTGAAA
GAGAATAAGCATGGGTTTTTGAATACAAAACGTGTTAAATGGAACTTTGAGAAATTCCTAGTCGATAGAGATGGTACTATTTTGAAGAGATATTCAAC
GTTGCAAAAGGCAAAAAAACAT
ATAGACAAAGATTTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCCAATAATGCAACAATCAACAGATGTTGTCAATTTCCATGACCTATACACATTTGATTGTGATGATAATCCAATATATTTCCATTCATTTATTGGGAAAATAGTGCTGGTCGCC
AATGTTGCTACACAATGTGCCTCTGCTTATCAACTTCGACAACTAGAAGCCCTATATCAAAAATATAAAGATAGAGACTTTGTGGTGTTAGCATTCCCTTCTAATCAGTTTCATCAAGAA
AAGAGAGGAACCAATCAAGAAGTTGCTGACAATTGTCGAAAAAGGTTTGACGTATCATTCCCAATAATGGAGAAAGTTAAAGTGAATGGAAAGAACCAAAGTGAAGTATTTAGGTTTTTG
AAAGAGAATAAGCATGGGTTTTTGAATACAAAACGTGTTAAATGGAACTTTGAGAAATTCCTAGTCGATAGAGATGGTACTATTTTGAAGAGATATTCAAC
ACAAAGATTTGCTTGA

Retrieve as FASTA