Entry information : TmesGPx01_Fries
Entry ID 10106
Creation 2012-01-06 (Passaia Gisèle)
Last sequence changes 2012-01-06 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: TmesGPx01_Fries
Name TmesGPx01_Fries
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3007]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Tremella
Organism Tremella mesenterica    [TaxId: 5217 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmesGPx01_Fries
start..stop
S start..stop
DcryGPx01 259 4e-91 1..151 1..151
CgaGPx01 256 1e-89 1..151 1..151
CnGPx01_H99 255 2e-89 1..151 1..151
CnGPx01_JEC21 254 6e-89 1..151 1..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 978373..978396 24 N° 2 978682..978763 82 N° 3 979081..979256 176 N° 4 979493..979642 150
N° 5 979707..979736 30  
join(978373..978396,978682..978763,979081..979256,979493..979642,979707..979736)


exon

Literature and cross-references TmesGPx01_Fries
DNA ref. JGI genome:   scaffold_10 (978373..979736)
Protein sequence: TmesGPx01_Fries
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   154
PWM (Da):   %s   17251.78  
PI (pH):   %s   4.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDIYSFTVQLPKDTIPLFEHKDKTLLFVNVASKCGLTPQYKDLQALYEKYNSKGLEIIGFPCNQFKGQEPGTDQEVLEFCQLNYGVTFPLAVADVNGPETQPLWAYLKSHAEPPVENIDWNFSKFLVKDGKVVWFPARSTKVNDVEAALGL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_10:978188-979833 (+), 4 introns) No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGACATATATTCTTTTACCGTAAGTCTTCCTTTTCACCCACTATTATCCTCTCATCTAAGACGAAAAACCCTTCTATTCTCGTGGATCTCCATCACGAATGACACTTCCATAATC
ACCAAAACTCAAGTCATTTATACAATCATCAGACGGACCATCATTCTACCTCCTCTATGACTAAGACCATGACAATTTGTTCGGTCAAAAGCGTCCATCGATTGACCCTGATGAACGGTG
TGATCTACTAAACCGAAGAAATGGGGAAAGACGAATGGAGTGGGGAAGATTAAGTATTGATGAAATCAGGTTCAACTACCTAAAGATACCATCCCTCTATTCGAACATAAAGACAAGACG
TTGTTATTCGTCAATGTAGCTAGCAAATGTG
GTCAGTACTTCCTTTCCTTATTAATCTTCATCCATACAACTCCTTTTCTTCTTACTTTTCACCCATACAACAACTCTCAAAATAACCCA
CTTTCATCACTAAACCATAATCCTCTACCGACGTCTTCCATTCATTGTTCTAATTCTCATCCTTCTCGACCTTCTATCATTCACTCTGCAATCACACATCCAGAATTCCTTTGTTTCACC
TACTTATCCCAAACTTCCTTACTCACCTACCCCAAGTACCATTGACTTCACTATCATTTTCCCCAAGTCGAGTCGAGACAAATTGCCCGAATCACAACTGACGCCAAGGCCTCACACCGC
AATACAAAGACCTTCAAGCTTTATACGAAAAATACAATTCCAAAGGTCTTGAAATCATCGGATTCCCATGTAATCAATTCAAAGGACAAGAACCAGGTACGGATCAAGAAGTTTTGGAAT
TTTGTCAATTGAATTATGGTGTTACTTTTCCTTTGGCCGTCAAG
GTGGGTGGATGGTACTGTATATTGTTCATTCCCCCTGTTCCGGGATCGTATAAATTTCCTCGACCTTTCTTTGGGA
TCATGATGCGTTCTGCCACTACTTTCTCACGACACATCTACTTGTCTCGGAATCATAATGCGTTCTCCCATCACTTTCCCACCGATATCTAACTATCAAATGAGATCTCGCTGAACCCCT
TACCATACAAGTGGATAAAGATAAGTTTCACTAACCCAAGGCGGACGTTAATGGACCTGAAACTCAACCACTTTGGGCTTATCTCAAATCTCATGCGGAACCACCCGTCGAAAATATCGA
TTGGAACTTTTCCAAGTTTTTAGTTAAAGATGGTAAAGTTGTGTGGTTCCCCGCTAGGAGCACTAAAGTT
GTGAGTTGTCTTTATTCGTCATTTCCAATGATAGAGGATCAGAAAGCATG
TCACTAATGGTCAGAACGACGTTGAAGCTGCTCTAGGTTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGACATATATTCTTTTACCGTTCAACTACCTAAAGATACCATCCCTCTATTCGAACATAAAGACAAGACGTTGTTATTCGTCAATGTAGCTAGCAAATGTGGCCTCACACCGCAA
TACAAAGACCTTCAAGCTTTATACGAAAAATACAATTCCAAAGGTCTTGAAATCATCGGATTCCCATGTAATCAATTCAAAGGACAAGAACCAGGTACGGATCAAGAAGTTTTGGAATTT
TGTCAATTGAATTATGGTGTTACTTTTCCTTTGGCCGTCAAG
GCGGACGTTAATGGACCTGAAACTCAACCACTTTGGGCTTATCTCAAATCTCATGCGGAACCACCCGTCGAAAATATC
GATTGGAACTTTTCCAAGTTTTTAGTTAAAGATGGTAAAGTTGTGTGGTTCCCCGCTAGGAGCACTAAAGTT
AACGACGTTGAAGCTGCTCTAGGTTTGTAG

Retrieve as FASTA