Entry information : TmesGPx02_Fries
Entry ID 10107
Creation 2012-01-06 (Passaia Gisèle)
Last sequence changes 2012-01-06 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: TmesGPx02_Fries
Name TmesGPx02_Fries
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Tremella
Organism Tremella mesenterica    [TaxId: 5217 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmesGPx02_Fries
start..stop
S start..stop
DcryGPx02 254 5e-88 9..180 5..183
DcryGPx03 251 2e-86 9..180 5..183
CgaGPx02 244 1e-83 1..181 1..186
CnGPx02_JEC21 242 5e-83 1..180 1..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2580554..2580673 120 N° 2 2580924..2580973 50 N° 3 2581031..2581172 142 N° 4 2581419..2581454 36
N° 5 2581502..2581590 89 N° 6 2581835..2581961 127  
join(2580554..2580673,2580924..2580973,2581031..2581172,2581419..2581454,2581502 ..2581590,2581835..2581961)


exon

Literature and cross-references TmesGPx02_Fries
DNA ref. JGI genome:   scaffold_2 (2580554..2581961)
Protein sequence: TmesGPx02_Fries
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   20817.51  
PI (pH):   %s   6.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPLLSSLSSMVGFESISPEIRAKSFYDLKATLPGKKELDFSQFKGKVVLIINTASKCGFTPQYTDLESLYKTYHDQGLEVLGFPCDQFAHQEPLDDDGIASFCVNHGVTFPLMAKSDVNGKNMNEVFAWLKAKMPGVAGTTNIKWNFTKFLIDRKGNVIHRYSPNTKPESFKGDIEKLLSEPAPEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_2:2580554-2581961 (+), 5 introns) No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTTGTTATCTTCTTTATCCAGTATGGTAGGGTTCGAAAGTATTTCCCCTGAAATAAGGGCAAAGTCTTTCTACGATCTTAAAGCTACTTTACCGGGAAAGAAAGAACTTGATTTT
GTCAGTTGTTTCCTTTCTCTCTCTCTCCTCTTCTCTGTCTTTGTCTTCCTTCTCTTATCACCTGTCATTCATCCCATTCAAGTATCAAATCTGAGAACGATTCCACTCGAAGATGGTCGC
TTCTTCTTATTCATGCTCATCGGATCATCGGGTCAGAATATGTTTCGTAAATGAGACATTCCATGATCGTCATCATAGTACATACATAAATCACCGTAATAAGAAGCACGGTCAGAGCTT
ATATGGGTAGAGTCAATTCAAAGGCAAAGTCGTGCTTATCATCAATACCGCTAGCAAATGGTATGTTCACAAAATCTCAGAGGGCCAAACGGGTTTGGGTTTGGGGCTAATGAGAAGCGG
TTTCACTCCTCAATATACAGATCTGGAGTCGTTGTACAAGACTTATCATGATCAAGGTTTAGAAGTATTGGGATTTCCATGTGATCAATTCGCACATCAAGAACCGTTGGATGATGATGG
TATTGCTTCGTTTTGTCAA
GTGAGTGGCGATCATCTCTTTCGTAACTCAGACTCTTCATCGCACCCCCTCCCCTTCCTTACAAAAAGAAAGGAATATGCATTCTTTCTGATTCCTCTCCT
TTCCTGGATTCTGTGGTGTTGTCAACATCAGTCCCGCCGTTAGATATGAAAGCGACCGTGTGTCTCAAGAACAATTCTGTTCGATGGGTACCAGATAGTCGAACAACCGAAAACGAAAAC
CTTTGTGTACACATACTGACATCAGGTCAACCACGGAGTAACCTTCCCCCTCATGGCCAAAGTGAGTTCCTCTCATCCCCATTTCTCCTCATAAATGCTCATAAATAGTCCGATGTGAAT
GGTAAAAATATGAACGAAGTTTTTGCGTGGTTGAAAGCTAAAATGCCCGGTGTGGCCGGGACGACCAATATCAAGTG
GTCAGTCCATGTTGATTACGCCTCTTCCCCACTCCATATCCCC
TCGTTTAATCCTCACTTTCACCTGTCTTGTCATTATAGACTTGCTCATCCCCCAAGAATTTGTTCACGTATTCGTTGCGTTCATCCGACATTTTCTGAGTAACGAAATCTCCTCTGAGTA
ACGAAACTCCATCTGAGTGAGACATCGTCAGAACGGGATAGATATCAAGAAAGGTCATAGGATGGCGATATTGACCAATAGGAACTTCACCAAATTCCTCATTGATAGAAAAGGGAATGT
CATCCATCGTTATTCACCCAATACTAAGCCAGAGTCATTCAAGGGTGATATCGAGAAACTTCTCTCGGAACCGGCACCTGAGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTTGTTATCTTCTTTATCCAGTATGGTAGGGTTCGAAAGTATTTCCCCTGAAATAAGGGCAAAGTCTTTCTACGATCTTAAAGCTACTTTACCGGGAAAGAAAGAACTTGATTTT
AGTCAATTCAAAGGCAAAGTCGTGCTTATCATCAATACCGCTAGCAAATGCGGTTTCACTCCTCAATATACAGATCTGGAGTCGTTGTACAAGACTTATCATGATCAAGGTTTAGAAGTA
TTGGGATTTCCATGTGATCAATTCGCACATCAAGAACCGTTGGATGATGATGGTATTGCTTCGTTTTGTCAA
GTCAACCACGGAGTAACCTTCCCCCTCATGGCCAAATCCGATGTGAAT
GGTAAAAATATGAACGAAGTTTTTGCGTGGTTGAAAGCTAAAATGCCCGGTGTGGCCGGGACGACCAATATCAAGTG
GAACTTCACCAAATTCCTCATTGATAGAAAAGGGAATGTCATC
CATCGTTATTCACCCAATACTAAGCCAGAGTCATTCAAGGGTGATATCGAGAAACTTCTCTCGGAACCGGCACCTGAGGCTTGA

Retrieve as FASTA