Entry information : RrufGPx01
Entry ID 10108
Creation 2012-01-06 (Passaia Gisèle)
Last sequence changes 2012-01-06 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: RrufGPx01
Name RrufGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Patellariaceae Rhytidhysteron
Organism Rhytidhysteron rufulum    [TaxId: 37885 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RrufGPx01
start..stop
S start..stop
HpulGPx01 298 6e-105 13..166 71..224
LpaluGPx01 281 6e-98 13..165 81..233
GsteGPx01 274 4e-96 13..164 15..166
CgeoGPx01 266 8e-93 13..165 15..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1012..1164 153 N° 2 601..948 348  
complement(join(601..948,1012..1164))


exon

Literature and cross-references RrufGPx01
DNA ref. JGI genome:   NODE_516_length_42527_cov_43.061375 (1164..601)
Protein sequence: RrufGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18533.57  
PI (pH):   %s   9.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRLALTSMAPVEKGKEYPLANLKNKVVLVVNTASKCGFTPQFAGLEKLYKDIGAQHPDFTIIGFPCNQFGSQDPGTNDEIQEFCQVNYGVSFPILGKIDVNGNNADPLYEWMKSEKPGVMGLKRIKWNFEKFLIGRDGKVKGRWFSTTKPDQLKDAIEKELAAKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (NODE_516_length_42527_cov_43.061375:601-1164 (-), 1 intron) No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACGTCTTGCGCTAACCAGCATGGCACCCGTAGAAAAGGGCAAGGAGTACCCTCTTGCAAACCTCAAAAACAAAGTCGTCCTCGTCGTAAACACGGCCTCGAAGTGCGGCTTTACC
CCTCAATTTGCCGGCCTTGAGAAGCTGTACAAG
GTATGTTCATTTCACCCGCCCCTCCTTTTCCGCGTCCTCGCAACTAACATACCGGACCCATAGGATATTGGCGCTCAACATCCCGAT
TTTACCATCATCGGCTTCCCTTGCAACCAATTTGGTAGCCAAGATCCTGGTACCAACGACGAAATCCAGGAATTTTGCCAGGTCAACTACGGCGTGTCGTTTCCTATTCTCGGCAAGATC
GACGTTAATGGAAATAACGCAGACCCCTTGTATGAATGGATGAAGAGCGAGAAGCCGGGTGTCATGGGACTCAAGCGTATCAAATGGAATTTCGAGAAGTTCCTGATAGGAAGAGATGGA
AAGGTCAAGGGGCGATGGTTCAGTACAACAAAGCCTGACCAGCTAAAGGATGCCATTGAGAAGGAACTGGCCGCTAAGGCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACGTCTTGCGCTAACCAGCATGGCACCCGTAGAAAAGGGCAAGGAGTACCCTCTTGCAAACCTCAAAAACAAAGTCGTCCTCGTCGTAAACACGGCCTCGAAGTGCGGCTTTACC
CCTCAATTTGCCGGCCTTGAGAAGCTGTACAAG
GATATTGGCGCTCAACATCCCGATTTTACCATCATCGGCTTCCCTTGCAACCAATTTGGTAGCCAAGATCCTGGTACCAACGACGAA
ATCCAGGAATTTTGCCAGGTCAACTACGGCGTGTCGTTTCCTATTCTCGGCAAGATCGACGTTAATGGAAATAACGCAGACCCCTTGTATGAATGGATGAAGAGCGAGAAGCCGGGTGTC
ATGGGACTCAAGCGTATCAAATGGAATTTCGAGAAGTTCCTGATAGGAAGAGATGGAAAGGTCAAGGGGCGATGGTTCAGTACAACAAAGCCTGACCAGCTAAAGGATGCCATTGAGAAG
GAACTGGCCGCTAAGGCATAG

Retrieve as FASTA