Entry information : NfDyPrx02
Entry ID 10129
Creation 2012-01-09 (Christophe Dunand)
Last sequence changes 2012-01-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-09 (Christophe Dunand)
Peroxidase information: NfDyPrx02
Name NfDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Neosartorya
Organism Neosartorya fischeri    [TaxId: 36630 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NfDyPrx02
start..stop
S start..stop
AclDyPrx02 1021 0 1..545 1..545
AcarDyPrx02 920 0 1..544 1..545
AorDyPrx02 910 0 1..543 1..541
AflDyPrx02 907 0 1..543 1..552
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4650509..4650817 309 N° 2 4650889..4651271 383 N° 3 4651326..4651415 90 N° 4 4651471..4651688 218
N° 5 4651754..4652134 381 N° 6 4652192..4652457 266  
join(4650509..4650817,4650889..4651271,4651326..4651415,4651471..4651688,4651754 ..4652134,4652192..4652457)


exon

Literature and cross-references NfDyPrx02
DNA ref. GenBank:   NW_001509770.1 (4650509..4652457)
Protein sequence: NfDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   548
PWM (Da):   %s   62008.82  
PI (pH):   %s   5.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPVDKQERVVDTDNIQGSIWPRLPKYYESYLFFKITNKERFRIHLRDILDNGEITTGTQCEDHLKSTGELEEACASSRRDIPEADRKPFTAVNVAFTHMGLLKVEPPGVEAKFAATLEKDPDDYCRDRINEGLFEKGMFDDLVYEGADSPAALHPDFRAPPGNETKQDLERWEWRVDGVFIVAAHTAKAVRKKVYDLEDAFNVGDANRASMKIAFRRDGQQRPGANRGKEHFGYEDHISQPRIKGLDDPPAKGEPHACPPGYIFLGHKGDPNLKRGPEWAKEGSFLVFRQLDQKVPEFERFLEEWAPQVPGTNYNGPNGAAKLGAHLMGRWKGAPVAKALDEDNPDLAFDNKFDFRPKKSIKGCPFAAHIRKMRPRADKKRDVGTEEDGDTTELPEPDSDESEAEGQEEDASVILRRGITFGPELTEQEKRERRTIEQRGIYFTCYQSLIRDGFNFLMTRWASNSSFPEYKTKTFPDGPGMDPFVNQRLRSDHPEGHISLYDGSNPDKTVKLNLGISPWVDQKGGEYFFTPSIKALREQFSTSVQVQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTCGACAAGCAAGAGCGAGTGGTCGACACCGACAACATCCAGGGCAGCATCTGGCCCCGTCTCCCCAAGTACTATGAATCCTACCTCTTTTTTAAGATCACCAATAAAGAGAGG
TTCAGAATACACCTCAGAGATATCCTTGACAATGGGGAGATCACCACCGGCACTCAATGCGAGGACCACCTGAAGTCAACTGGCGAGCTGGAAGAAGCATGTGCAAGCTCCCGACGTGAT
ATTCCCGAAGCAGACCGGAAGCCTTTTACCGCAGTGAACGTCGCCTTCACCCACATGGGCTTGCTCAAG
GTTCGCCGCTCTCTCTCCAATTACGTACTGGTTTGATAACTGTGTATATTG
ATATGTTGACACTTTCTCAGGTGGAACCTCCTGGAGTTGAAGCAAAATTTGCCGCGACTCTGGAAAAGGATCCGGATGATTATTGCAGGGATAGGATCAACGAAGGTCTTTTCGAAAAAG
GAATGTTCGATGACCTCGTCTATGAAGGTGCCGATAGCCCTGCTGCTTTGCATCCGGACTTCAGGGCTCCTCCCGGAAACGAAACTAAGCAAGACCTTGAACGTTGGGAGTGGAGAGTCG
ACGGTGTTTTCATTGTCGCTGCCCACACTGCGAAAGCTGTGCGCAAGAAGGTTTATGATCTGGAAGATGCCTTCAATGTTGGGGATGCGAATCGGGCCAGTATGAAGATTGCCTTCAGAA
GAGATGGCCAACAGCGTCCTGGTGCAAACCGTGGCAAAGAGCA
GTACGGTTTCTCCTACTTTCATTTTATTGTCTGTGAATGCTGCTGATTCTATAGCTTTGGTTACGAGGATCACATCT
CTCAACCAAGGATTAAAGGCCTGGATGATCCCCCAGCCAAGGGTGAACCCCATGCCTGTCCTCCTGG
GTGTGTCAGACCCTGTTAACAGCTCGATTGTTAATTGCCCGTTAACAGGACTT
AGGTACATTTTTCTGGGCCACAAAGGTGACCCGAATCTGAAAAGAGGCCCTGAGTGGGCTAAGGAGGGCAGTTTCCTCGTCTTTCGTCAGCTCGACCAAAAGGTTCCCGAATTTGAAAGG
TTCCTCGAGGAATGGGCACCGCAAGTCCCAGGAACCAACTATAACGGACCCAATGGTGCTGCGAAGCTGGGTGCTCATCTGATGGGACGATGGAAGAGCG
GTGGGCCTACCATCCCCATA
TCTTGTTATGATCCACCGACTAGGCAAGAGCTAATCGACAATCAGGAGCCCCTGTCGCCAAGGCCCTTGATGAGGACAATCCAGACTTGGCATTCGACAACAAGTTTGATTTCAGACCCA
AGAAGAGTATCAAAGGTTGTCCGTTTGCCGCTCACATCCGCAAGATGCGTCCTCGAGCCGATAAGAAACGTGATGTCGGGACTGAAGAAGATGGCGATACCACGGAGCTTCCGGAGCCAG
ACAGTGACGAGTCTGAGGCCGAAGGACAAGAAGAGGATGCTAGTGTCATCCTCCGTCGTGGTATCACCTTTGGACCTGAACTCACCGAGCAGGAAAAGCGGGAGAGGAGAACAATTGAAC
AACGAGGGATCTACTTTACATGCTACCAGAGTCTTATTCGGGACGGGTTCAACTTCCTCATGACTC
GTAAGTTTACCATATATTCAATCATCTGGAATCTGCCTACGATGCTAATAAATA
TAGGCTGGGCGAGTAACTCATCCTTCCCTGAGTATAAGACCAAGACTTTCCCCGACGGGCCTGGTATGGACCCCTTTGTCAACCAGAGACTCCGATCCGATCATCCCGAGGGTCACATAA
GTTTATATGATGGAAGCAATCCAGACAAGACTGTTAAGCTTAATCTTGGTATCAGTCCGTGGGTTGATCAGAAAGGTGGTGAATACTTTTTCACTCCTTCCATCAAGGCCTTAAGGGAGC
AATTTTCAACTTCCGTTCAGGTCCAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTCGACAAGCAAGAGCGAGTGGTCGACACCGACAACATCCAGGGCAGCATCTGGCCCCGTCTCCCCAAGTACTATGAATCCTACCTCTTTTTTAAGATCACCAATAAAGAGAGG
TTCAGAATACACCTCAGAGATATCCTTGACAATGGGGAGATCACCACCGGCACTCAATGCGAGGACCACCTGAAGTCAACTGGCGAGCTGGAAGAAGCATGTGCAAGCTCCCGACGTGAT
ATTCCCGAAGCAGACCGGAAGCCTTTTACCGCAGTGAACGTCGCCTTCACCCACATGGGCTTGCTCAAG
GTGGAACCTCCTGGAGTTGAAGCAAAATTTGCCGCGACTCTGGAAAAGGAT
CCGGATGATTATTGCAGGGATAGGATCAACGAAGGTCTTTTCGAAAAAGGAATGTTCGATGACCTCGTCTATGAAGGTGCCGATAGCCCTGCTGCTTTGCATCCGGACTTCAGGGCTCCT
CCCGGAAACGAAACTAAGCAAGACCTTGAACGTTGGGAGTGGAGAGTCGACGGTGTTTTCATTGTCGCTGCCCACACTGCGAAAGCTGTGCGCAAGAAGGTTTATGATCTGGAAGATGCC
TTCAATGTTGGGGATGCGAATCGGGCCAGTATGAAGATTGCCTTCAGAAGAGATGGCCAACAGCGTCCTGGTGCAAACCGTGGCAAAGAGCA
CTTTGGTTACGAGGATCACATCTCTCAA
CCAAGGATTAAAGGCCTGGATGATCCCCCAGCCAAGGGTGAACCCCATGCCTGTCCTCCTGG
GTACATTTTTCTGGGCCACAAAGGTGACCCGAATCTGAAAAGAGGCCCTGAGTGGGCT
AAGGAGGGCAGTTTCCTCGTCTTTCGTCAGCTCGACCAAAAGGTTCCCGAATTTGAAAGGTTCCTCGAGGAATGGGCACCGCAAGTCCCAGGAACCAACTATAACGGACCCAATGGTGCT
GCGAAGCTGGGTGCTCATCTGATGGGACGATGGAAGAGCG
GAGCCCCTGTCGCCAAGGCCCTTGATGAGGACAATCCAGACTTGGCATTCGACAACAAGTTTGATTTCAGACCCAAGAAG
AGTATCAAAGGTTGTCCGTTTGCCGCTCACATCCGCAAGATGCGTCCTCGAGCCGATAAGAAACGTGATGTCGGGACTGAAGAAGATGGCGATACCACGGAGCTTCCGGAGCCAGACAGT
GACGAGTCTGAGGCCGAAGGACAAGAAGAGGATGCTAGTGTCATCCTCCGTCGTGGTATCACCTTTGGACCTGAACTCACCGAGCAGGAAAAGCGGGAGAGGAGAACAATTGAACAACGA
GGGATCTACTTTACATGCTACCAGAGTCTTATTCGGGACGGGTTCAACTTCCTCATGACTC
GCTGGGCGAGTAACTCATCCTTCCCTGAGTATAAGACCAAGACTTTCCCCGACGGGCCT
GGTATGGACCCCTTTGTCAACCAGAGACTCCGATCCGATCATCCCGAGGGTCACATAAGTTTATATGATGGAAGCAATCCAGACAAGACTGTTAAGCTTAATCTTGGTATCAGTCCGTGG
GTTGATCAGAAAGGTGGTGAATACTTTTTCACTCCTTCCATCAAGGCCTTAAGGGAGCAATTTTCAACTTCCGTTCAGGTCCAATAG

Retrieve as FASTA