Entry information : OsPrx03 (OS01G15830)
Entry ID 1013
Creation 2006-06-23 (Filippo Passardi)
Last sequence changes 2006-06-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx03 (OS01G15830)
Name (synonym) OsPrx03 (OS01G15830)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx03
start..stop
S start..stop
BdiPrx55 630 0 1..334 5..337
SiPrx17 628 0 1..332 5..332
BdiPrx56 625 0 1..334 5..334
SbPrx54 624 0 1..334 5..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8916863..8917090 228 N° 2 8917745..8917936 192 N° 3 8918115..8918280 166 N° 4 8918373..8918794 422
join(8916863..8917090,8917745..8917936,8918115..8918280,8918373..8918794)


exon

Literature and cross-references OsPrx03 (OS01G15830)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9LI45
DNA ref. GenBank:   NC_008394.1 (8916863..8918791)
Protein sequence: OsPrx03 (OS01G15830)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (314)
PWM (Da):   %s   36206.15 (34054.0)  
PI (pH):   %s   8.09 (8.19) Peptide Signal:   %s   cut: 22 range:22-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGCLLMLCLVSPLLLATSVHGNPWYGYGYGLFPQFYDHSCPKAKEIVQSIVAQAVARETRMAASLVRLHFHDCFVKGCDASVLLDNSTTIISEKGSNPNMNSLRGFEVVDEIKAALEAACPGTVSCADILALAARDSTVLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNIVDVVALSGGHTIGMSRCTSFRQRLYNQSGNGMADYTLDVSYAAQLRQGCPRSGGDNNLFPLDFVSPAKFDNFYFKNILSGKGLLSSDQVLLTKSAETAALVKAYADDVNLFFKHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNYYH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 30 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTGCCTGTTGATGCTCTGCTTGGTTTCTCCCCTCCTCCTCGCCACCTCTGTCCACGGCAACCCGTGGTATGGGTATGGGTATGGCTTGTTCCCGCAGTTCTACGACCACTCGTGC
CCCAAGGCGAAGGAGATCGTGCAGTCCATCGTAGCACAGGCGGTGGCCAGGGAGACCAGGATGGCGGCATCCTTGGTCAGGCTGCATTTTCATGACTGCTTTGTCAAG
GTACTGTGATTT
CTCTTCTGCTGTAGCATTCTTTACTTGTCTTCACAAAGCTAATGGTGCTCGGTTGACATAGCACCTGCAGTGTAGCCTGCAAAAACATAATTCAAATGAGTTGTATGCTTAGTGCAACTA
GAAAGGCAATTATATGCGTTTCACTTGCTTTTGCGATGGTTAAATCCATATGAAGGTATTGCAAATAGTCATCAAAAATAGAGAAAAAAAAGACATGTATTTGCAGATGCAACTTTAGCT
GTTACATAACGAAAACGCAAAGTGTAGGAGATCAAACCTTTGTTATATTTGTACCTAGGTATTAAAAAAGGTACCCTTAGGAGCATGGAAGAATCTATAGTTATTAGGCAAACTTTTTAC
CACTGATAAGATAGCCTACCAACATTGCCCATGCGAGCACTACTTTCTGCCTTGGTGATATGATGAGTCCGTACCATGATTTCTTGATTATTCACTTTCTTTTCAAAGAGAGGATGACTA
TTTAATTCAAATGCACAATAATTGGCGCTCTCGATGTTTCATTTATCAGAGACCTTCACCCAGTACAGGACCCTAAATCAATATATATTTTGCTGTTCCGTTGCATGTGCCTAATCTATG
TACTACTTCCATGTACCTAATCTATGTACCAACATTGTGTAGGGGTGTGACGCGTCTGTGCTCCTGGACAACAGCACCACCATCATCAGTGAGAAGGGGTCAAACCCTAACATGAACTCC
CTCAGGGGTTTCGAGGTCGTCGACGAGATCAAGGCCGCCCTCGAAGCAGCTTGCCCCGGCACCGTCTCCTGCGCCGACATACTCGCCCTCGCTGCACGCGATTCCACTGTCCTC
GTATGT
AGCAGAGATAAGCTCTATCAGAACCACACAAAAGAATATCACATTCGGAAATAGAAGGAGAAATGAACTGTGTATTATTATTATTTCTGTATGAGCTTAGAGAAAAGAACCGCTCCTAGG
ATGAGCTCAACAGTGCCGTGTTTTGTGACTGAATTTGCACTCAAACCTGCAGGTTGGTGGCCCGTACTGGGATGTGCCACTTGGCCGGAGGGACTCACTGGGTGCCAGCATCCAGGGCTC
CAACAACGACATCCCAGCTCCCAACAACACCCTCCCCACCATCATCACCAAGTTCAAGCGCCAGGGCCTTAACATCGTCGACGTCGTAGCCCTCTCAG
GTGAACTTCTTCTTACCATCTT
ATGAGTATGTGCGTCCATTTCTTGAGAGAGATCTTTCTTACATTGCACAAAAATGGGTGCATACATACAGGTGGCCACACCATTGGCATGTCTCGGTGCACCAGCTTCCGTCAGAGGCTC
TACAATCAGAGCGGCAATGGCATGGCTGACTACACACTGGATGTGTCCTACGCGGCACAGCTGAGGCAGGGATGCCCCCGTTCTGGTGGTGACAACAACCTCTTCCCGCTAGACTTTGTC
AGCCCCGCAAAGTTCGACAACTTCTACTTCAAGAACATCCTGTCTGGCAAGGGCCTTCTCAGCTCTGATCAGGTCCTGCTTACCAAGAGCGCTGAAACAGCGGCGCTCGTGAAGGCGTAT
GCTGATGATGTCAACCTCTTCTTCAAGCACTTCGCACAGTCAATGGTGAATATGGGCAACATCTCGCCTCTGACTGGATCACAGGGGGAGATCAGGAAGAACTGCAGGAGGCTCAACAAC
TACTACCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTGCCTGTTGATGCTCTGCTTGGTTTCTCCCCTCCTCCTCGCCACCTCTGTCCACGGCAACCCGTGGTATGGGTATGGGTATGGCTTGTTCCCGCAGTTCTACGACCACTCGTGC
CCCAAGGCGAAGGAGATCGTGCAGTCCATCGTAGCACAGGCGGTGGCCAGGGAGACCAGGATGGCGGCATCCTTGGTCAGGCTGCATTTTCATGACTGCTTTGTCAAG
GGGTGTGACGCG
TCTGTGCTCCTGGACAACAGCACCACCATCATCAGTGAGAAGGGGTCAAACCCTAACATGAACTCCCTCAGGGGTTTCGAGGTCGTCGACGAGATCAAGGCCGCCCTCGAAGCAGCTTGC
CCCGGCACCGTCTCCTGCGCCGACATACTCGCCCTCGCTGCACGCGATTCCACTGTCCTC
GTTGGTGGCCCGTACTGGGATGTGCCACTTGGCCGGAGGGACTCACTGGGTGCCAGCATC
CAGGGCTCCAACAACGACATCCCAGCTCCCAACAACACCCTCCCCACCATCATCACCAAGTTCAAGCGCCAGGGCCTTAACATCGTCGACGTCGTAGCCCTCTCAG
GTGGCCACACCATT
GGCATGTCTCGGTGCACCAGCTTCCGTCAGAGGCTCTACAATCAGAGCGGCAATGGCATGGCTGACTACACACTGGATGTGTCCTACGCGGCACAGCTGAGGCAGGGATGCCCCCGTTCT
GGTGGTGACAACAACCTCTTCCCGCTAGACTTTGTCAGCCCCGCAAAGTTCGACAACTTCTACTTCAAGAACATCCTGTCTGGCAAGGGCCTTCTCAGCTCTGATCAGGTCCTGCTTACC
AAGAGCGCTGAAACAGCGGCGCTCGTGAAGGCGTATGCTGATGATGTCAACCTCTTCTTCAAGCACTTCGCACAGTCAATGGTGAATATGGGCAACATCTCGCCTCTGACTGGATCACAG
GGGGAGATCAGGAAGAACTGCAGGAGGCTCAACAACTACTACCACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTGCC TGTTGATGCT CTGCTTGGTT TCTCCCCTCC TCCTCGCCAC CTCTGTCCAC GGCAACCCGT GGTATGGGTA TGGGTATGGC TTGTTCCCGC AGTTCTACGA CCACTCGTGC  CCCAAGGCGA AGGAGATCGT GCAGTCCATC GTAGCACAGG CGGTGGCCAG GGAGACCAGG ATGGCGGCAT CCTTGGTCAG GCTGCATTTT CATGACTGCT TTGTCAAGGG GTGTGACGCG  TCTGTGCTCC TGGACAACAG CACCACCATC ATCAGTGAGA AGGGGTCAAA CCCTAACATG AACTCCCTCA GGGGTTTCGA GGTCGTCGAC GAGATCAAGG CCGCCCTCGA AGCAGCTTGC  CCCGGCACCG TCTCCTGCGC CGACATACTC GCCCTCGCTG CACGCGATTC CACTGTCCTC GTTGGTGGCC CGTACTGGGA TGTGCCACTT GGCCGGAGGG ACTCACTGGG TGCCAGCATC  CAGGGCTCCA ACAACGACAT CCCAGCTCCC AACAACACCC TCCCCACCAT CATCACCAAG TTCAAGCGCC AGGGCCTTAA CATCGTCGAC GTCGTAGCCC TCTCAGGTGG CCACACCATT  GGCATGTCTC GGTGCACCAG CTTCCGTCAG AGGCTCTACA ATCAGAGCGG CAATGGCATG GCTGACTACA CACTGGATGT GTCCTACGCG GCACAGCTGA GGCAGGGATG CCCCCGTTCT  GGTGGTGACA ACAACCTCTT CCCGCTAGAC TTTGTCAGCC CCGCAAAGTT CGACAACTTC TACTTCAAGA ACATCCTGTC TGGCAAGGGC CTTCTCAGCT CTGATCAGGT CCTGCTTACC  AAGAGCGCTG AAACAGCGGC GCTCGTGAAG GCGTATGCTG ATGATGTCAA CCTCTTCTTC AAGCACTTCG CACAGTCAAT GGTGAATATG GGCAACATCT CGCCTCTGAC TGGATCACAG 
GGGGAGATCA GGAAGAACTG CAGGAGGCTC AACAACTACT ACCACTGA 

Retrieve as FASTA