Entry information : AcarDyPrx01
Entry ID 10131
Creation 2012-01-09 (Christophe Dunand)
Last sequence changes 2012-01-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AcarDyPrx01
Name AcarDyPrx01
Class DyP-type peroxidase B    [Orthogroup: DyPrxB001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus carbonarius    [TaxId: 40993 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcarDyPrx01
start..stop
S start..stop
HpulDyPrx 480 8e-171 62..370 1..308
AflDyPrx01 477 2e-168 11..370 19..371
OmaiDyPrx 472 2e-167 64..375 2..310
AorDyPrx01 473 7e-167 11..375 19..376
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39992..41104 1113 N° 2 39812..39953 142 N° 3 39656..39732 77  
complement(join(39656..39732,39812..39953,39992..41104))


exon

Literature and cross-references AcarDyPrx01
DNA ref. JGI genome:   scaffold_18 (41104..39656)
Cluster/Prediction ref. JGI gene:   210874
Protein sequence: AcarDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   444
PWM (Da):   %s   48473.83  
PI (pH):   %s   7.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHRIGHLLVRHSSRPFPQPLHSLSRCLSSFLPSIPPSTSTIHPRRPFPLPIKHHHPRPQSTMTSRTTIRPQSVDAPLTQFATFLVLTVNSTTPSALSTVRTTLAALSDLTKNITIRDLSARFTCTVGIGSAIWDPLTRLPRPAELRPFPDIHGAVHTALATPGDLLFHIRSERRDLCFEFERQLLDRLGDAVTVVDETEGFRYFDMRDLLGFVDGTANPIGPAVPEAVLVTQEADTAGVGGSYVVVQKYLHDLAAWKSLSTEQQEAIIGRTKVDNIELDDAEAGAQQSHKSLATIEDENGEEHAIVRDNMPFGAPGKGEFGTYFIGYTARLWVIETMLQRMFVGEPSGKHDRILDFSTPTTGGTFFAPSAGEQQGYLARGLDVATGRVSTHGPSRGGNPGSLHHPHKRAVYSAASDRAFKGPGAIGVHLHKMLVQKRMQEMNG*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACCGCATTGGCCATCTACTCGTCCGTCATTCGTCCCGGCCATTCCCCCAGCCCTTGCACTCGCTCTCCCGCTGCCTCTCATCATTCCTCCCCTCCATCCCTCCCTCCACCTCGACC
ATCCATCCCCGTCGCCCATTCCCTCTCCCCATCAAACACCACCACCCTCGCCCTCAATCCACCATGACCTCCCGAACCACCATCCGACCCCAAAGCGTCGACGCCCCTCTCACCCAATTC
GCCACCTTCCTCGTCCTGACCGTCAACTCCACCACCCCGTCCGCCCTCTCTACCGTCCGCACCACCCTCGCTGCCCTCTCCGACCTCACCAAAAACATCACCATCCGCGACCTCTCCGCC
CGCTTCACCTGCACCGTCGGCATCGGCAGTGCCATCTGGGACCCGCTCACCCGTCTCCCCCGCCCCGCCGAACTGCGCCCATTCCCCGACATCCACGGCGCCGTGCACACGGCCCTCGCC
ACCCCCGGCGATCTCCTCTTCCATATCCGCTCCGAGCGACGCGATCTGTGCTTCGAGTTCGAGCGCCAACTCCTCGATCGCCTCGGCGACGCCGTCACCGTCGTGGATGAGACCGAGGGG
TTTCGCTATTTCGATATGCGCGATCTCTTAGGGTTCGTGGATGGCACCGCCAACCCGATTGGCCCCGCCGTGCCGGAGGCCGTGCTGGTCACGCAGGAGGCGGACACCGCGGGGGTCGGG
GGCAGTTATGTCGTCGTGCAGAAATATCTGCATGATCTGGCCGCGTGGAAATCCCTCTCCACGGAACAACAAGAGGCTATCATTGGGCGGACCAAAGTGGATAATATCGAGTTGGACGAT
GCGGAGGCGGGTGCGCAGCAGTCGCATAAGTCCCTGGCGACCATCGAGGACGAGAACGGGGAGGAGCATGCGATTGTGCGGGATAACATGCCCTTTGGCGCCCCGGGGAAGGGCGAGTTC
GGCACGTATTTCATTGGGTATACGGCGCGGTTGTGGGTGATTGAGACGATGTTGCAGCGGATGTTTGTGGGAGAGCCCAGCGGGAAACATGATCGGATTTTGGACTTTTCGACCCCGACC
ACCGGAGGGACCTTTTTTGCCCCGTCGGCGGGC
GTCTTGGAGGGGTTGGGGGAGGAGTAACGGGGGTGCAGGAACAGCAGGGGTATCTGGCTAGGGGGTTGGATGTAGCTACTGGTAGGG
TCAGTACCCATGGACCATCGAGAGGAGGGAATCCGGGGTCCCTCCATCATCCGCATAAAAGGGCAGTTTACTCCGCCGCGTCCGACAGAGCAT
GTTCAGCAGACACTTTTCGATCCCCTG
GTGGGCTTCCAGACTCAGATGGCTGACGACATCCGTCATCTGCGTCACGTAGTCAAAGGTCCGGGCGCCATTGGGGTACACTTGCACAAAATGCTCGTGCAGAAACGCATGCAGGAGATG
AATGGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACCGCATTGGCCATCTACTCGTCCGTCATTCGTCCCGGCCATTCCCCCAGCCCTTGCACTCGCTCTCCCGCTGCCTCTCATCATTCCTCCCCTCCATCCCTCCCTCCACCTCGACC
ATCCATCCCCGTCGCCCATTCCCTCTCCCCATCAAACACCACCACCCTCGCCCTCAATCCACCATGACCTCCCGAACCACCATCCGACCCCAAAGCGTCGACGCCCCTCTCACCCAATTC
GCCACCTTCCTCGTCCTGACCGTCAACTCCACCACCCCGTCCGCCCTCTCTACCGTCCGCACCACCCTCGCTGCCCTCTCCGACCTCACCAAAAACATCACCATCCGCGACCTCTCCGCC
CGCTTCACCTGCACCGTCGGCATCGGCAGTGCCATCTGGGACCCGCTCACCCGTCTCCCCCGCCCCGCCGAACTGCGCCCATTCCCCGACATCCACGGCGCCGTGCACACGGCCCTCGCC
ACCCCCGGCGATCTCCTCTTCCATATCCGCTCCGAGCGACGCGATCTGTGCTTCGAGTTCGAGCGCCAACTCCTCGATCGCCTCGGCGACGCCGTCACCGTCGTGGATGAGACCGAGGGG
TTTCGCTATTTCGATATGCGCGATCTCTTAGGGTTCGTGGATGGCACCGCCAACCCGATTGGCCCCGCCGTGCCGGAGGCCGTGCTGGTCACGCAGGAGGCGGACACCGCGGGGGTCGGG
GGCAGTTATGTCGTCGTGCAGAAATATCTGCATGATCTGGCCGCGTGGAAATCCCTCTCCACGGAACAACAAGAGGCTATCATTGGGCGGACCAAAGTGGATAATATCGAGTTGGACGAT
GCGGAGGCGGGTGCGCAGCAGTCGCATAAGTCCCTGGCGACCATCGAGGACGAGAACGGGGAGGAGCATGCGATTGTGCGGGATAACATGCCCTTTGGCGCCCCGGGGAAGGGCGAGTTC
GGCACGTATTTCATTGGGTATACGGCGCGGTTGTGGGTGATTGAGACGATGTTGCAGCGGATGTTTGTGGGAGAGCCCAGCGGGAAACATGATCGGATTTTGGACTTTTCGACCCCGACC
ACCGGAGGGACCTTTTTTGCCCCGTCGGCGGGC
GAACAGCAGGGGTATCTGGCTAGGGGGTTGGATGTAGCTACTGGTAGGGTCAGTACCCATGGACCATCGAGAGGAGGGAATCCGGGG
TCCCTCCATCATCCGCATAAAAGGGCAGTTTACTCCGCCGCGTCCGACAGAGCAT
TCAAAGGTCCGGGCGCCATTGGGGTACACTTGCACAAAATGCTCGTGCAGAAACGCATGCAGGAG
ATGAATGGATGA

Retrieve as FASTA