Entry information : HpulCcP
Entry ID 10139
Creation 2012-01-16 (Christophe Dunand)
Last sequence changes 2012-01-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-10-15 (Catherine Mathe (Scipio))
Peroxidase information: HpulCcP
Name HpulCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Hysteriaceae Hysterium
Organism Hysterium pulicare    [TaxId: 100027 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpulCcP
start..stop
S start..stop
GsteCcP01 563 0 1..318 1..318
RrufCcP01 525 0 1..318 1..318
ApruCcP02 520 0 1..318 1..318
CcassCcP01 497 1e-179 1..318 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 271480..271589 110 N° 2 271652..272498 847  
join(271480..271589,271652..272498)


exon

Literature and cross-references HpulCcP
DNA ref. JGI genome:   NODE_8253_length_347971_cov_26.533918 (271480..272498)
Cluster/Prediction ref. JGI gene:   11418
Protein sequence: HpulCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318
PWM (Da):   %s   35426.61  
PI (pH):   %s   5.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKTGDYEAVRKSIIGLLDQPEYDDGSVGPVLVRLAWHSAGTYDTSTDTGGSNGAGMRYEAEGGDPANAGLQHARVFLEPVKAKHDWITYSDLWTLAGCVAIEAMGGPKIAWLPGRTDFVDDSRLPPRGRLPDGAKGADHIRHIFYRMGFNDQEIVALSGAHNLGRCHTDRSGFEGKWVHSPTRFSNQYFRLMVRLDWQPKKLQNGVLQFVHVDEDLDEELMMLPTDMALLAEPSFSGWVKRYAEDKEVFYADFANVFAKLLELGIRRDADGKVLNTDNLNGGYVSAPKKSDEPRLPRVSNEESESLQKENERFKARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAAACCGGAGACTACGAAGCAGTCCGCAAATCTATAATTGGGTTGCTAGATCAACCGGAGTATGATGATGGTAGCGTAGGGCCGGTCTTGGTACGGTTGGCATGGTAAGTATCA
GTATTCTTCCGTGAACGAGCGCTTTCTATGTCGAGACTGACTTTACCCATAGGCATTCTGCAGGCACATACGACACATCAACCGATACAGGAGGCTCGAATGGGGCAGGAATGCGTTACG
AAGCTGAAGGAGGCGATCCCGCAAACGCCGGTCTACAGCACGCACGCGTCTTCCTCGAACCAGTCAAGGCCAAGCACGACTGGATAACCTACTCAGATCTCTGGACACTCGCCGGATGCG
TGGCCATCGAAGCGATGGGCGGGCCCAAAATCGCTTGGCTACCCGGACGTACCGATTTTGTGGATGATTCGAGGTTACCTCCTCGAGGCCGACTACCGGACGGGGCGAAGGGTGCCGACC
ATATTCGGCATATATTCTACCGTATGGGCTTCAACGATCAGGAGATCGTTGCTTTGTCTGGTGCACATAATCTAGGACGTTGTCATACGGATCGCAGTGGGTTCGAAGGAAAGTGGGTGC
ATAGTCCTACACGGTTCAGCAATCAGTACTTCCGCCTGATGGTGCGGTTAGACTGGCAACCGAAGAAACTTCAAAACGGGGTGCTGCAATTCGTTCACGTTGACGAGGATCTTGACGAAG
AGCTGATGATGTTGCCAACGGATATGGCGCTACTCGCGGAGCCGAGCTTTAGTGGATGGGTGAAGCGGTATGCCGAAGACAAAGAGGTGTTCTATGCCGATTTTGCCAATGTATTTGCGA
AGTTGTTAGAGCTCGGCATACGAAGGGATGCGGATGGAAAGGTCCTGAACACTGATAATCTTAATGGTGGTTACGTATCGGCACCAAAGAAGTCTGACGAGCCTCGTTTGCCGAGAGTAT
CCAATGAAGAGTCGGAATCTCTCCAAAAGGAGAACGAGAGATTCAAGGCAAGATTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAAACCGGAGACTACGAAGCAGTCCGCAAATCTATAATTGGGTTGCTAGATCAACCGGAGTATGATGATGGTAGCGTAGGGCCGGTCTTGGTACGGTTGGCATGGCATTCTGCA
GGCACATACGACACATCAACCGATACAGGAGGCTCGAATGGGGCAGGAATGCGTTACGAAGCTGAAGGAGGCGATCCCGCAAACGCCGGTCTACAGCACGCACGCGTCTTCCTCGAACCA
GTCAAGGCCAAGCACGACTGGATAACCTACTCAGATCTCTGGACACTCGCCGGATGCGTGGCCATCGAAGCGATGGGCGGGCCCAAAATCGCTTGGCTACCCGGACGTACCGATTTTGTG
GATGATTCGAGGTTACCTCCTCGAGGCCGACTACCGGACGGGGCGAAGGGTGCCGACCATATTCGGCATATATTCTACCGTATGGGCTTCAACGATCAGGAGATCGTTGCTTTGTCTGGT
GCACATAATCTAGGACGTTGTCATACGGATCGCAGTGGGTTCGAAGGAAAGTGGGTGCATAGTCCTACACGGTTCAGCAATCAGTACTTCCGCCTGATGGTGCGGTTAGACTGGCAACCG
AAGAAACTTCAAAACGGGGTGCTGCAATTCGTTCACGTTGACGAGGATCTTGACGAAGAGCTGATGATGTTGCCAACGGATATGGCGCTACTCGCGGAGCCGAGCTTTAGTGGATGGGTG
AAGCGGTATGCCGAAGACAAAGAGGTGTTCTATGCCGATTTTGCCAATGTATTTGCGAAGTTGTTAGAGCTCGGCATACGAAGGGATGCGGATGGAAAGGTCCTGAACACTGATAATCTT
AATGGTGGTTACGTATCGGCACCAAAGAAGTCTGACGAGCCTCGTTTGCCGAGAGTATCCAATGAAGAGTCGGAATCTCTCCAAAAGGAGAACGAGAGATTCAAGGCAAGATTGTAA

Retrieve as FASTA