Entry information : OsPrx04 (OS01G16450)
Entry ID 1014
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx04 (OS01G16450)
Name (synonym) OsPrx04 (OS01G16450)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx04
start..stop
S start..stop
SbPrx55 524 0 4..321 22..339
ZmPrx84 513 0 22..321 42..341
SiPrx11 507 0 16..320 38..341
SpPrx02 501 1e-180 4..321 23..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9339169..9339396 228 N° 2 9340208..9340954 747  
join(9339169..9339396,9340208..9340954)


exon

Literature and cross-references OsPrx04 (OS01G16450)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9LDL0
DNA ref. GenBank:   NC_008394.1 (9339169..9340951)
Protein sequence: OsPrx04 (OS01G16450)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (302)
PWM (Da):   %s   33820.02 (31630.9) Transmb domain:   %s   i3-25o
PI (pH):   %s   7.92 (8.19) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDLAWWFAVAVVVCGLVGGGSAGLLETNPGLAYNFYQKSCPNVDSIVRSVTWAQVAANPALPGRLLRLHFHDCFVQGCDASILLDNAGSEKTAGPNLSVGGYEVIDAIKTQLEQACPGVVSCADIVALAARDAVSYQFKASLWQVETGRRDGPVSLASNTGALPSPFAGFSTLLQSFANRGLNLTDLVALSGAHTIGKASCSSVTPRLYQGNTTSLDPLLDSAYAKALMSSCPNPSPSSSTIDLDVATPLKFDSGYYANLQKKQGALASDAALTQNAAAAQMVADLTNPIKFYAAFSMSMKKMGRIDVLTGSKGNIRKQCRSAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 30 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTTGGCGTGGTGGTTCGCGGTGGCCGTGGTGGTGTGCGGCCTTGTGGGGGGCGGCAGCGCCGGGCTGCTGGAGACCAACCCGGGTTTGGCGTACAACTTCTACCAGAAGTCGTGC
CCCAACGTGGACTCCATCGTCCGCAGCGTCACCTGGGCGCAGGTCGCCGCCAACCCGGCGCTCCCCGGCCGCCTCCTCCGCCTCCACTTCCATGACTGCTTCGTCCAG
GTCAGTGCCAGC
AAAAATACTCCCGTTTCTTCGCTGCTTCAGCTCTCTCCAAGCCCCCATTTCGCCGTGTCGGCGCCGTGCCGCGCGCCGGCCTAGCTAGCCAGCCATGGCCGGTTTTCTTTCTCCCTGTCT
ACATCCTGAGAGGAATTAACTGCGAGAGCCACCATTTCGAGCTACCTAGCTCTAGCTACAGTCTAGAGGCCTTCACTGGTCCTGCATTCTTTGCATGGCGTCGATTGGGGACGAAACGAG
GCTCAAGTGAACCGGGGTTTTTACCGCGGTGGTTCGTGGCTTTTACTCTGATTTTCACAGTGGCGGGAGGACCAGCCGAGAAGATATTATCTTGCTTTTCGCCTGTGCCTGTACACATAT
ACGTAAGCATTACGGCACCTTTTCCCCGGTTCGCGGCAGCGCGAGGCGAGGGGCGAGGCGGTCGCGACGCGCCAAAGCAACGAGACAAACGGGAAAAATACTGCGTGCCTAGTACAGGGG
GGGAGCACGCCGAATCTTGTCGTATTTTTCCCCCCATTTTTTTTCCCCGTGCGGCCCGTGCGTTGCGTTGCCGTGCAGCTCACATGCGGCGCTGAGCCGATGCATCGCGCGCGACAGCTA
AGCTTATCAAAGCTGCCGCGCCCTGTACGGCGCCCATGCATGCCATGCATGGGCCATGGCCACACCACCGGCCTTGGCCCCCTTGCTCCCGCGATTTTTTTTCAAACCCTGCAAAGCGCA
GCTGTTTGTGGCCGCGTGTCAATGGCGCCTGGCTGACCGGTCGGTTTTCTTCTTTTTGTGTGTGTGGTTTTGCGTGCAGGGGTGCGACGCGTCGATCTTGCTGGACAACGCCGGGAGCGA
GAAGACGGCGGGGCCGAACCTATCGGTGGGGGGATACGAGGTGATCGACGCCATCAAGACGCAGCTGGAGCAGGCGTGCCCCGGGGTGGTGTCGTGCGCGGACATCGTGGCGCTCGCCGC
GCGCGACGCCGTGTCGTACCAGTTCAAGGCGTCGCTGTGGCAGGTGGAGACCGGGAGGCGCGACGGGCCCGTGTCTCTGGCGTCCAACACCGGCGCGCTGCCGTCGCCGTTCGCCGGGTT
CAGCACGCTCCTCCAGAGCTTCGCCAACCGCGGGCTCAACCTGACCGACCTCGTCGCGCTCTCCGGCGCGCACACCATCGGCAAGGCCAGCTGCTCCAGCGTCACGCCGCGGCTGTACCA
GGGGAACACCACCTCCCTCGACCCGCTGCTCGACTCCGCCTACGCCAAGGCGCTCATGTCGTCGTGCCCCAACCCGTCGCCGTCGTCGTCCACCATCGACCTCGACGTCGCCACGCCGCT
CAAGTTCGACAGCGGTTACTACGCCAACCTGCAGAAGAAGCAGGGCGCGCTGGCGTCCGACGCCGCGCTCACCCAGAACGCCGCCGCGGCGCAGATGGTGGCAGACCTCACCAACCCGAT
CAAGTTCTACGCCGCGTTCTCCATGTCCATGAAGAAGATGGGACGCATCGACGTGCTCACCGGCAGCAAAGGGAATATCAGGAAGCAGTGCCGCTCCGCCTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTTGGCGTGGTGGTTCGCGGTGGCCGTGGTGGTGTGCGGCCTTGTGGGGGGCGGCAGCGCCGGGCTGCTGGAGACCAACCCGGGTTTGGCGTACAACTTCTACCAGAAGTCGTGC
CCCAACGTGGACTCCATCGTCCGCAGCGTCACCTGGGCGCAGGTCGCCGCCAACCCGGCGCTCCCCGGCCGCCTCCTCCGCCTCCACTTCCATGACTGCTTCGTCCAG
GGGTGCGACGCG
TCGATCTTGCTGGACAACGCCGGGAGCGAGAAGACGGCGGGGCCGAACCTATCGGTGGGGGGATACGAGGTGATCGACGCCATCAAGACGCAGCTGGAGCAGGCGTGCCCCGGGGTGGTG
TCGTGCGCGGACATCGTGGCGCTCGCCGCGCGCGACGCCGTGTCGTACCAGTTCAAGGCGTCGCTGTGGCAGGTGGAGACCGGGAGGCGCGACGGGCCCGTGTCTCTGGCGTCCAACACC
GGCGCGCTGCCGTCGCCGTTCGCCGGGTTCAGCACGCTCCTCCAGAGCTTCGCCAACCGCGGGCTCAACCTGACCGACCTCGTCGCGCTCTCCGGCGCGCACACCATCGGCAAGGCCAGC
TGCTCCAGCGTCACGCCGCGGCTGTACCAGGGGAACACCACCTCCCTCGACCCGCTGCTCGACTCCGCCTACGCCAAGGCGCTCATGTCGTCGTGCCCCAACCCGTCGCCGTCGTCGTCC
ACCATCGACCTCGACGTCGCCACGCCGCTCAAGTTCGACAGCGGTTACTACGCCAACCTGCAGAAGAAGCAGGGCGCGCTGGCGTCCGACGCCGCGCTCACCCAGAACGCCGCCGCGGCG
CAGATGGTGGCAGACCTCACCAACCCGATCAAGTTCTACGCCGCGTTCTCCATGTCCATGAAGAAGATGGGACGCATCGACGTGCTCACCGGCAGCAAAGGGAATATCAGGAAGCAGTGC
CGCTCCGCCTCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTTGG CGTGGTGGTT CGCGGTGGCC GTGGTGGTGT GCGGCCTTGT GGGGGGCGGC AGCGCCGGGC TGCTGGAGAC CAACCCGGGT TTGGCGTACA ACTTCTACCA GAAGTCGTGC  CCCAACGTGG ACTCCATCGT CCGCAGCGTC ACCTGGGCGC AGGTCGCCGC CAACCCGGCG CTCCCCGGCC GCCTCCTCCG CCTCCACTTC CATGACTGCT TCGTCCAGGG GTGCGACGCG  TCGATCTTGC TGGACAACGC CGGGAGCGAG AAGACGGCGG GGCCGAACCT ATCGGTGGGG GGATACGAGG TGATCGACGC CATCAAGACG CAGCTGGAGC AGGCGTGCCC CGGGGTGGTG  TCGTGCGCGG ACATCGTGGC GCTCGCCGCG CGCGACGCCG TGTCGTACCA GTTCAAGGCG TCGCTGTGGC AGGTGGAGAC CGGGAGGCGC GACGGGCCCG TGTCTCTGGC GTCCAACACC  GGCGCGCTGC CGTCGCCGTT CGCCGGGTTC AGCACGCTCC TCCAGAGCTT CGCCAACCGC GGGCTCAACC TGACCGACCT CGTCGCGCTC TCCGGCGCGC ACACCATCGG CAAGGCCAGC  TGCTCCAGCG TCACGCCGCG GCTGTACCAG GGGAACACCA CCTCCCTCGA CCCGCTGCTC GACTCCGCCT ACGCCAAGGC GCTCATGTCG TCGTGCCCCA ACCCGTCGCC GTCGTCGTCC  ACCATCGACC TCGACGTCGC CACGCCGCTC AAGTTCGACA GCGGTTACTA CGCCAACCTG CAGAAGAAGC AGGGCGCGCT GGCGTCCGAC GCCGCGCTCA CCCAGAACGC CGCCGCGGCG  CAGATGGTGG CAGACCTCAC CAACCCGATC AAGTTCTACG CCGCGTTCTC CATGTCCATG AAGAAGATGG GACGCATCGA CGTGCTCACC GGCAGCAAAG GGAATATCAG GAAGCAGTGC 
CGCTCCGCCT CCTGA 

Retrieve as FASTA