Entry information : OsPrx05
Entry ID 1015
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx05
Name OsPrx05
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx05
start..stop
S start..stop
BdiPrx53 603 0 1..345 1..346
SiPrx10 594 0 1..347 1..347
SbPrx52 580 0 1..347 1..347
ZmPrx46 573 0 1..347 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8904125..8904388 264 N° 2 8903805..8903996 192 N° 3 8903390..8903555 166 N° 4 8902598..8903019 422
complement(join(8902598..8903019,8903390..8903555,8903805..8903996,8904125..8904 388))


exon

Literature and cross-references OsPrx05
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9LDY1
DNA ref. GenBank:   NC_008394.1 (8904388..8902601)
Protein sequence: OsPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (324)
PWM (Da):   %s   38380.68 (36067.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.96 (7.77) Peptide Signal:   %s   cut: 24 range:24-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSKTVLSAIFTASLCFTVALAFPAHHEDLHPVVQSPPKPVLSPDYYKATCPQADEIVVSVLKKAIAKEQRIAASLLRLLFHDCFVQGCDASVLLDDSEEFVSEKKAIPNKNSIRGFEVIDEIKAALEEACPHTVSCADTIALAARGSTVLSGGPYWELPLGRKDSKAAYMKLANKNLPPPNATLHRLVKFFERQGLDKVDLVALSGSHTIGMARCVSFKQRLYNQHRDNQPDKTLERMFYSTLASTCPRNGGDNNLRPLEFATPSKFDNTYYKLLIEGRGLLNSDEVLWTGRDPQIAGLVRSYAENEPLFFEHYVNSITKMGNINPLTGYDGEIRKNCRVVNKKI

Retrieve as FASTA  
Remarks complete sequence genomic (chromo 1) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATCCAAGACTGTTCTTTCTGCAATTTTCACTGCTTCTCTGTGCTTCACTGTAGCTCTTGCTTTCCCTGCTCACCATGAGGATCTTCACCCAGTTGTGCAGAGCCCACCAAAG
CCAGTTCTTTCTCCAGATTACTATAAGGCTACATGCCCACAAGCTGATGAGATTGTGGTCTCTGTCCTAAAGAAGGCTATTGCCAAGGAGCAGAGGATTGCTGCTTCTCTTCTCAGGCTC
CTGTTCCATGACTGCTTTGTTCAG
GTTAGCACATTTTCAAGTGTCCTCCTTGTTCTAAAAGAACACAAAATTTCTAGAAGGAAACACAATTTTCAGTGTTCACTCATTGATATAAATGAG
AAGTGGTTTTGATCGTCTCGATGAAATTTCAGGGATGCGACGCGTCGGTTTTGTTGGATGACAGTGAAGAATTCGTGAGCGAGAAAAAGGCTATTCCTAACAAAAATTCTATTAGAGGAT
TTGAAGTTATAGACGAGATCAAGGCTGCACTTGAAGAAGCTTGTCCACACACAGTCTCTTGTGCTGACACCATTGCCCTAGCTGCGAGAGGTTCAACAGTTCTG
GTAAACATCTCTGCTC
TTAAAATTAAAAAAAAAAACTTCATTCATCTGTTTAAAATATAGACTTCATTCTTTTTCAAGAGAACACAATAAGAGAATTTCTGAAAGCAACTACAATACTTTGGTTCATCTTGTTTGG
ATGTAGATGTATATATAACACTGGCATTTCAAGTAAAAATAATGTTTCTAACCTCAGTTTAAAATTATCTACCACAAGCATGATGAAATTTAATGGTTTTTATCTCATGACAGAGCGGTG
GCCCATACTGGGAACTTCCACTAGGAAGGAAGGATTCAAAGGCAGCATATATGAAATTAGCAAACAAGAACCTTCCTCCACCAAATGCGACACTGCATCGTCTTGTGAAATTCTTTGAAA
GGCAAGGACTGGATAAGGTGGACCTTGTGGCACTGTCAG
GTATTGAATTAATTCCACCTCTTCAGTGTTGAAACTAGATTTTTTTTGAGGTAATGTAGTAAAAAAAAATCCGGCGGAATA
AAATAGATTTGTTTGTACATGTTCTCCACATCAGTTTCTTGTCACATGTTTAATCTTTCAAAGTACTGCAAGAACCTAGAAAAGATGAGAAAAACACTGAAACAAAGCATAACTAGCAAT
GAAATTTGCCAGAAAATTAAGTGAACAACAAATATAAGGATAGTGTAGCTCTAGTCATACTGGGATAATTAAAATGCTAATCCAAACCATCCTCCTGCATTAACATAATTGAAACAACTA
ATAATATTTTTCTCACCAAACAAATACATACATTTTTCTGCATTGACAGGAAGCCACACCATTGGAATGGCCAGATGTGTGAGCTTCAAGCAGAGGCTCTACAACCAGCACAGAGACAAC
CAGCCTGACAAAACGCTAGAGAGAATGTTCTACTCCACACTGGCCTCAACATGCCCACGCAACGGCGGTGACAACAACTTACGCCCACTGGAGTTTGCTACCCCTTCGAAATTCGACAAC
ACCTATTACAAGCTGCTGATCGAGGGAAGAGGGCTCCTCAATTCAGATGAAGTTCTGTGGACAGGACGAGACCCGCAGATCGCGGGTCTCGTCAGAAGCTATGCAGAAAACGAACCGCTG
TTCTTCGAGCACTACGTGAACTCGATAACCAAGATGGGGAACATCAATCCCCTCACTGGTTACGACGGAGAAATCCGCAAGAACTGCCGTGTGGTTAACAAGAAGATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATCCAAGACTGTTCTTTCTGCAATTTTCACTGCTTCTCTGTGCTTCACTGTAGCTCTTGCTTTCCCTGCTCACCATGAGGATCTTCACCCAGTTGTGCAGAGCCCACCAAAG
CCAGTTCTTTCTCCAGATTACTATAAGGCTACATGCCCACAAGCTGATGAGATTGTGGTCTCTGTCCTAAAGAAGGCTATTGCCAAGGAGCAGAGGATTGCTGCTTCTCTTCTCAGGCTC
CTGTTCCATGACTGCTTTGTTCAG
GGATGCGACGCGTCGGTTTTGTTGGATGACAGTGAAGAATTCGTGAGCGAGAAAAAGGCTATTCCTAACAAAAATTCTATTAGAGGATTTGAAGTT
ATAGACGAGATCAAGGCTGCACTTGAAGAAGCTTGTCCACACACAGTCTCTTGTGCTGACACCATTGCCCTAGCTGCGAGAGGTTCAACAGTTCTG
AGCGGTGGCCCATACTGGGAACTT
CCACTAGGAAGGAAGGATTCAAAGGCAGCATATATGAAATTAGCAAACAAGAACCTTCCTCCACCAAATGCGACACTGCATCGTCTTGTGAAATTCTTTGAAAGGCAAGGACTGGATAAG
GTGGACCTTGTGGCACTGTCAG
GAAGCCACACCATTGGAATGGCCAGATGTGTGAGCTTCAAGCAGAGGCTCTACAACCAGCACAGAGACAACCAGCCTGACAAAACGCTAGAGAGAATG
TTCTACTCCACACTGGCCTCAACATGCCCACGCAACGGCGGTGACAACAACTTACGCCCACTGGAGTTTGCTACCCCTTCGAAATTCGACAACACCTATTACAAGCTGCTGATCGAGGGA
AGAGGGCTCCTCAATTCAGATGAAGTTCTGTGGACAGGACGAGACCCGCAGATCGCGGGTCTCGTCAGAAGCTATGCAGAAAACGAACCGCTGTTCTTCGAGCACTACGTGAACTCGATA
ACCAAGATGGGGAACATCAATCCCCTCACTGGTTACGACGGAGAAATCCGCAAGAACTGCCGTGTGGTTAACAAGAAGATCTAG

Retrieve as FASTA