Entry information : Egr2CysPrx01 (Eucgr.K02606 / Egrandis_v1_0.022528m)
Entry ID 10151
Creation 2012-01-24 (Christophe Dunand)
Last sequence changes 2012-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: Egr2CysPrx01 (Eucgr.K02606 / Egrandis_v1_0.022528m)
Name (synonym) Egr2CysPrx01 (Eucgr.K02606 / Egrandis_v1_0.022528m)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Egr2CysPrx01
start..stop
S start..stop
Egl2CysPrx01 560 0 1..277 1..277
Egu2CysPrx01 556 0 1..277 1..277
Pt2CysPrx01 437 2e-157 1..277 1..269
Vv2CysPrx01 427 2e-153 1..277 1..273
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33812671..33812910 240 N° 2 33813720..33813794 75 N° 3 33813952..33814033 82 N° 4 33814156..33814235 80
N° 5 33814746..33814871 126 N° 6 33815210..33815323 114 N° 7 33815445..33815561 117  
join(33812671..33812910,33813720..33813794,33813952..33814033,33814156..33814235 ,33814746..33814871,33815210..33815323,33815445..33815561)


exon

Literature and cross-references Egr2CysPrx01 (Eucgr.K02606 / Egrandis_v1_0.022528m)
DNA ref. Phytozome 11:   scaffold_11 (33812671..33815561)
Protein sequence: Egr2CysPrx01 (Eucgr.K02606 / Egrandis_v1_0.022528m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   277
PWM (Da):   %s   29929.47  
PI (pH):   %s   8.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSAASTTLISSNPASSSSSSSLAKKSLSPVMLSSPRSVAVPKSISALANPFLSSRIPRSVAPSRASNSRRSSFSVKASSELPLVGNVAPNFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEKLNTEVLGVSVDSFSHLAWIQTDRKSGGLGDLKYPLISDVTKSISKSYDVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFAAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCAGCTGCTTCGACCACCCTCATCTCCTCCAACCCCGCCTCCTCCTCCTCCTCCTCCTCCTTGGCCAAGAAGTCCCTGTCCCCCGTGATGCTCTCCTCCCCCCGGAGCGTC
GCTGTCCCCAAGTCCATCTCCGCTCTCGCCAACCCCTTCCTCTCTTCTCGCATCCCCAGATCGGTCGCTCCCTCCCGCGCCTCCAATTCCAGGCGCAGCAGCTTCTCCGTCAAGGCCTCC
GTACGTGTTTTCCCAAGAAACTTAATTCGTTGTTGGTGATTGAGTGCATTTGGGTTGTCAAGATGGTAGTTTCTGGGAATTGTTTTTATGGGATTGCCGTGAATTGCTGGTTGTCGTCCT
TGAGTCATAGCATTTGGGAGAGAGGAAAAAATGGTTTGAGGTTTTCTTTGTTGTTAGTGGTTTATGGTGTGATTAGCCCTGTGCTATGCGTGTGTGTTCTTTTCGGGTTGTAGTTTTATC
ACCGCTTAGGACTTATTTCAGATGAGGTTGATGCGATGCGTCCGTGCGCTACTCGGTTCTCTATCTGTCTGCTGAACTGGTCTGTAGTGATGTAGATTCCTAGTGCGAGCCTGCACAGCG
TAGTTGAGTAATCATATTGACTTTCAAATGTTGATGTCGTTGGCTAGTTGGGCCCGGCCAGTTCCTACAAGAATTCATAATGTGTGCTGACGTTACTGTGGAGCCAAAGGTTGTTCGTAG
AGAAATGATGAGGTTTATGGTTCTGTGTTCTTGATCATTTGAAGCACACTTCTGCCTGGCTGCCTGTAAATCTCAATTGGAGCTCACGGGCTGAGTGTAGAACTCAATGAGATCGCCAGA
ACCTCCTAAAGCTATTCACGTGTGATTGTTTTTCCATGACCCTTGTCATTGACTCGATCAGAATTCCCAAACTTGACACAAACTTCCAAACTTCGCCCTTCATCGTGCTCCTGTTTACTT
TGTGATACTTGTTGACCATGTCATTGATTTTCACTTTTTATGTTCAATTTGTATTCAAACTGAATGTATCATCTCACATCTTTGTTCAGAGTGAGCTTCCCCTTGTTGGAAATGTAGCAC
CAAATTTCGAGGCAGAGGCTGTCTTTGATCAGGAGTTCATCAAT
GTAGGTTATTCAATTCAGGACTTCATAAAGTCTGCAAGCATTTTTATTGGTTTTTTACAGTCACAACTTGATATCT
AACAGATTGATTCCTGGAGAATCAAATATGCAGCCTCTCATGAAGGTTCTTCTTAGTTTGCATATGTATTCTGCATTTCAGGTTAAGCTGTCAGATTACATTGGGAAGAAATATGTGATT
CTCTTCTTCTACCCATTAGACTTCACTTTTGTCTGCCCAACAG
GTTAGATGCTGAAGCATAGAAGTGCTTCTTAATCTCTGCAATATATTTAGTTTAATATAATTTGGTTTGTTTGGGTG
TAACATGATGTTTACAATTAACTAAGTTTTCTCTTCTTCTTGTAGAGATCACTGCATTTAGTGACCGACATGCAGAGTTCGAAAAGTTGAACACGGAAGTACTGGGTGTTTCTGTTGATA
GTGTG
GTGAGTTCTTTCTCCAAACTACGTTGAAACTTTAAATAGCCAGTATGCACATGAAGATACATGGTAAAGTTTCAGTATTCTCTAATTGCTTAGAGCTGGTAGAAGTTTTCACTTG
TAGCATGATTAAGTGAGGTCATATGCAATCTCTTGAGCCGGTGAAAATTCCCTTGTTACCAGAAAGAGGGAAAATAAAATGAACCATTATGATATGTTGTGATTTCCTTCTTCAACCCTG
ACACTGGGATGTCTGTGTGATTATAAAACACCGTCGCTCTGCAAAAGTGATGCCAATCAGCAAAATTTCATGTTGTATTCATGTTTTGAAACATCTAGATGCTTCATCATTATTTTTAGA
ATTTCCAGTGGATACCACTCATACCCTCTTGGGTGTTGTGCTAATGGCCAAAACTTCTTGCTATGTATGGTAGCTTCTGAAGTGATTAAAATTCGGGTGATGGTAGGGCCAAGGTACTGT
TTTGTGCTAATGATTATATCTCGTCCTCCTTGCAGTTTTCCCACCTTGCATGGATTCAAACAGATAGAAAGTCAGGTGGTCTTGGTGATCTTAAGTATCCACTTATATCTGATGTCACCA
AATCCATTTCAAAGTCATATGATGTACTTATCCCTGATCAG
GTATGATGACATTAATTCAGATACTTAAGTGGCATTTGTTTTCATGCTTTGCTCTGCATCATTGATTGGTCTCAATTCT
GGACTAAAGGGATGTTTCTTTCTGCGGTGTGTACTCTAGTCTCGCCATCTCTGTATTTAGACAAGAAATATCCTTCCATCAAGTGCTTGATTCATGCAAAACTTCCAAACATAAAACCTG
TCTTTTTTCCCTACAATCTGCTGTCATTTTCTTGATGTTGCTCATAATAGATGATAATCTGATCTGAATAGAATCTATTTCTTTGTTCTACTAGTCAAATTATATATACATATATAACAA
GTTCTTCTCACTGCATCAGGGAATTGCATTGAGAGGACTCTTTATCATTGACAAGGAAGGAGTTATTCAGCATTCCACCATCAATAATCTTGCCATTGGCCGCAGTGTTGACGAAACATT
GAGGACATTGCAG
GTAACTTAATTACGGTGGCTCTGCATGCTGCCAAGATACTATAATATGCTAGCTTAGGTCACTCTTACATAAAAGACTCAAAATATATCATCTTCACCATTGGGAAC
TTTCGTGTCTGCAGGCCTTGCAGTACGTGCAGGAAAACCCCGATGAGGTTTGCCCAGCTGGGTGGAAGCCTGGGGAGAAGTCCATGAAGCCAGACCCTAAGCTCAGCAAGGAGTACTTTG
CGGCCATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCAGCTGCTTCGACCACCCTCATCTCCTCCAACCCCGCCTCCTCCTCCTCCTCCTCCTCCTTGGCCAAGAAGTCCCTGTCCCCCGTGATGCTCTCCTCCCCCCGGAGCGTC
GCTGTCCCCAAGTCCATCTCCGCTCTCGCCAACCCCTTCCTCTCTTCTCGCATCCCCAGATCGGTCGCTCCCTCCCGCGCCTCCAATTCCAGGCGCAGCAGCTTCTCCGTCAAGGCCTCC
AGTGAGCTTCCCCTTGTTGGAAATGTAGCACCAAATTTCGAGGCAGAGGCTGTCTTTGATCAGGAGTTCATCAATGTTAAGCTGTCAGATTACATTGGGAAGAAATATGTGATTCTCTTC
TTCTACCCATTAGACTTCACTTTTGTCTGCCCAACAG
AGATCACTGCATTTAGTGACCGACATGCAGAGTTCGAAAAGTTGAACACGGAAGTACTGGGTGTTTCTGTTGATAGTGTGTTT
TCCCACCTTGCATGGATTCAAACAGATAGAAAGTCAGGTGGTCTTGGTGATCTTAAGTATCCACTTATATCTGATGTCACCAAATCCATTTCAAAGTCATATGATGTACTTATCCCTGAT
CAG
GGAATTGCATTGAGAGGACTCTTTATCATTGACAAGGAAGGAGTTATTCAGCATTCCACCATCAATAATCTTGCCATTGGCCGCAGTGTTGACGAAACATTGAGGACATTGCAGGCC
TTGCAGTACGTGCAGGAAAACCCCGATGAGGTTTGCCCAGCTGGGTGGAAGCCTGGGGAGAAGTCCATGAAGCCAGACCCTAAGCTCAGCAAGGAGTACTTTGCGGCCATATAG

Retrieve as FASTA