Entry information : EgrPrxII03 (Eucgr.C03812 / Egrandis_v1_0.029562m)
Entry ID 10153
Creation 2012-01-24 (Christophe Dunand)
Last sequence changes 2012-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrxII03 (Eucgr.C03812 / Egrandis_v1_0.029562m)
Name (synonym) EgrPrxII03 (Eucgr.C03812 / Egrandis_v1_0.029562m)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrxII03
start..stop
S start..stop
EguPrxII03 330 2e-118 1..162 1..162
EglPrxII03 330 2e-118 1..162 1..162
EcamPrxII03 330 2e-118 1..162 1..162
CsPrxII02 300 7e-107 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 71531992..71532146 155 N° 2 71532573..71532652 80 N° 3 71533874..71534127 254  
join(71531992..71532146,71532573..71532652,71533874..71534127)


exon

Literature and cross-references EgrPrxII03 (Eucgr.C03812 / Egrandis_v1_0.029562m)
DNA ref. Phytozome 11:   scaffold_3 (71531992..71534127)
Protein sequence: EgrPrxII03 (Eucgr.C03812 / Egrandis_v1_0.029562m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17219.98  
PI (pH):   %s   5.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDAIPDGTLAYFDEQDQLQQVSVHSLAAGKKAVLFAVPGAFTPTCSLKHVPGFIENAELLKSKGVDEILCLVNDPFVMKAWAKTYPENKHVKFLADGSAKYTHALGLELDLSEKGLGTRSRRFALLVEDLKVKAANIESGGEFTVSGADEILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCCGCCGGCAAGAAGGCCGTCCTC
TTCGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
GTGAGGGCCGCCGACTGCTTTTTTCTTTCTCGCCGTTCCCTCGTCCTGCGTCGCCGCCGGTTTGCGGTAGCGCGCGGGAGGGGAG
GGAGAGCGGGGGTGAATCGCAGCGTGAATCGTTGGGAATTCTTTGCCTAAATTGACGGTTTCATTTCTGTTTTCTAGAATGTTCTGTATTTCTTGAGTAGTGTGGAAGTGGTGTTCGATG
CGATTAGTTTCGTACGGTCGTGGCGAGGCTGTTAGATGTTTGTTTGGACCGAAACGAGTCATGATTCGTGAGCACCTGAATTCGTTTGGAAAATAGTGCATTATGCTACGGCCTGCTCGA
TTAAAGATGAGGTTTTTGGAGTGAATAACGCTGGAATTGTCACTAGCGATTGTAGCTTCGATCTTGCGGTATTACCGTTGTTTGTATCGTTCGATTTGCAGTCTGAAGCACGTGCCGGGC
TTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCG
GTATATTCTTTATCTTTTTCCGTCTCTGTGCGATTTCTTTCGTTCTTTTTTTTTTCAGA
GTTTGTGGACGATCGTTCCTCTTTATTTGTCGTCTAATATCGGCGTTTCTTGCTATATCCGCCGATGCTTTGTTTTAAAGGTTACACCTAATGTTTCTGTCCTTACTATTGAGTAATGTA
GTGTAGCGCATCTGCTCGTTAGTGACGAGGTAAAGAAGCTATCTTCAGTGAGTCGCCAAATATAATGGTTTCAGCAAGCATCAAGAATCTTAAACTTATAATAACGGGGATTGGGGACTG
TACTGGTTTTCTGGAGATTACAAGGAAATGCAAAAGGGACTCCAGTTTTGACTTTGAGCAGTTCTTTTGAGGCATTAGTCAGTAGTTGACCATTTCTTGTAGCGTTGCTTTCGTCACCCA
ATTGCTTGCCCAATTATTAGTTGGGAGTATTCACGAGTTGACTTTAAGCAGTTGTTACGAGGCATCAGTCAGGAGATAAATATATCATGTGTGATATTTTTCCTTGTTGCCGCTCTTCAA
AATCCACTTGCCGCTCTATCCATTAAATAGTTACAAACTGTTCTGGATAGCTTGCCTTCAGGCTTGGTAGTGTAGTTGGTGTAAGTCTAATTCCATCTAAAATTGTGCCTTGTGGTCAAG
AGAGATCCGATCATCTTGGCCTGGAATCTTCTTGGGAATCTTTAAATGGATGTGATTGGACACTCTCTCCCTCTCTGGGCGGGCCATGTGGTTTTACTTTTCAATCAAACTATTATGCTT
ATTAACCAAATGCTGGATTGCTAATGACACAGTGAGTTCAAGATCCTGCTTGGGAAACAACTACAGAAAGCTAGTCCAAAAAGAACTCGGTTTCTGGGTCCTAGGACACTTGAAAGAGCT
TGAATTGAAACTTTGCACCGTCATTAGTGAAAATATGGCTTTGCTTAACGCTCTCGTATCTTTACTTCTCTTGACTTTACTGCTGACCTTCCACCCCATACTGAGGATATGTGGCTGTGT
GAATTCCATATTTGATTCCAGAGTTGAGCTCCTAGATGTTGTATGGAGTCTATTAAAGAGTTTGCGCCATCCTTTAGTTAATAAAACGTGCTAGCTTTAGAACAGATGGCAGTTTGTCTG
TCTTAGGTAATCCAGTCCTACCATGTGTTTTTTGTTTTTTTCCCCTGAATATCGTGATGCTCATTTTGGTCCTATTTTTCAGTGAATGACCCATTTGTGATGAAGGCGTGGGCGAAGACT
TACCCCGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCGAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTAAGTGAGAAGGGGCTTGGGACTCGCTCCAGGAGATTTGCT
CTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACCGTCTCCGGTGCTGATGAAATCCTTAAAGCTCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCCGCCGGCAAGAAGGCCGTCCTC
TTCGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
TCTGAAGCACGTGCCGGGCTTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCGTGAAT
GACCCATTTGTGATGAAGGCGTGGGCGAAGACTTACCCCGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCGAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTAAGTGAG
AAGGGGCTTGGGACTCGCTCCAGGAGATTTGCTCTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACCGTCTCCGGTGCTGATGAAATCCTTAAA
GCTCTCTGA

Retrieve as FASTA