Entry information : EgrPrxII02 (Eucgr.B01112 / Egrandis_v1_0.027538m)
Entry ID 10154
Creation 2012-01-24 (Christophe Dunand)
Last sequence changes 2012-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrxII02 (Eucgr.B01112 / Egrandis_v1_0.027538m)
Name (synonym) EgrPrxII02 (Eucgr.B01112 / Egrandis_v1_0.027538m)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrxII02
start..stop
S start..stop
EcamPrxII02 394 1e-142 1..196 1..196
EguPrxII02 390 2e-141 1..196 1..196
EglPrxII02 338 1e-120 1..196 1..195
CclPrxII05 328 3e-116 1..196 24..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17478747..17478947 201 N° 2 17478611..17478640 30 N° 3 17477071..17477229 159 N° 4 17476291..17476385 95
N° 5 17476011..17476116 106  
complement(join(17476011..17476116,17476291..17476385,17477071..17477229,1747861 1..17478640,17478747..17478947))


exon

Literature and cross-references EgrPrxII02 (Eucgr.B01112 / Egrandis_v1_0.027538m)
DNA ref. Phytozome 11:   scaffold_2 (17478947..17476011)
Protein sequence: EgrPrxII02 (Eucgr.B01112 / Egrandis_v1_0.027538m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197
PWM (Da):   %s   20810.72  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLLAKRSSSSVLGGLWTGAARTYASVAVGGDIVSAAPGVSLQKARSWDEGVSSKFATTPVKDIFEGKKVVIFGLPGAYTGVCSQQHVPSYKNNIDKFKAKGIDSVICVAVNDPYTMNGWAENLKAKDAIEFYGDFDASFHKSLDLTKDLSAALLGLRSERWSAYVEDGKVKALNVEEAPSDLKVSGAEVILGQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCCGTCCTCGGCGGCCTATGGACGGGCGCGGCCAGGACCTACGCCTCGGTCGCCGTCGGCGGCGACATCGTCTCCGCGGCGCCGGGC
GTCTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTGTCAAGGATATCTTCGAG
GTTGGTTTTCGATTTCTTGCTGATTGCTTCATTCGCAGT
GGAAGTTCAGCTTCTGAATTTTTACTAATTTGCTTTGCCTGGGCTTCATTCGGACATGGGATTTCAGGGCAAGAAGGTGGTGATTTTCGGACTCCCGGTGAGTGAACTCTCGGCTCTTTC
ATGTCTGTAGTTTCGTGGGAAATAATCGAGCCCTTTTTGTCTTCTGGGCAGTTGATTCATGGGTGTCGATTGCAGCAAGCAATGTCTTCCTTATTTAGTGCTAACTTAGCGGCAAAGATT
GCTCTTTTTTTTCCGACATCTGAAATGGTTGAATAAGACAGAGGAGATGCGTCTGAATTGTCTAATGGGAATCGTTTCAATTATTCGTTTAATGGGTTGCTTTCATGTTCTCGCCTTATT
GGTTGGTGTCATCGTGTGGAGGCTTGAATAGATCGATAGATTATGATATGCAGCTAGACTTTGCCAATTGCCATGAGAGAGTCGTGTTATGCTCTTTGATAGCAAAAATAGAAATCTTTC
CTTTGAACTCTGCAAAGTTCTTATTTTTGAAAAGCTGGAAGGAGTTTATAGAAATCTGGAAAAGAGCCTAATAAATGAGATCATATTGAAATTTGATGTTTGACGCTTCTATGAAGTATT
GTCCCATTCTTCGAACATTTATTGTACTTGTGAAAAGGATAGGTGCTGGGTTCCTAGCGGAAACTTCAAAGGCACTGCAGTCCATAATATGAGATTGCATGCTAGTCCACCATGTTTAGG
TTCTGTGGTTCACTTACTTCATGATCCTAGCTGCATCATTGACGAAAATTTGGACATCGAGGTGACTATTTAACCAACTTGTTATAACTTCCAACCAAAATGAAAGTAAAAAAGAAAAAA
CGATTTGGATTTAGACAATTTTAAATAAGTTTCACCAGACATTAATGTTATAATTCACGTACTTTTTTATATCGAGGTGTTCAATACTAGATAAAAGTCAATCTAAAACACTAAAAGCAA
AAAATAGAAATAAGAAGTTGAAAAACATGTAACCTTGAACAAAACTTGCACAACAAAGTTAGTATGTTTAGAGAAAACTTTGTTGTTGTCTGTTAATAATGTAGTTTGATGCGATGCCAT
ATTTAATCTTCCATCTTACCTCTTAAAGCATTTCTAGTTTTATATACACCATATTTCTATTTTTTTAATTTGTACCCAAGTCCTTGATGCTGAATTCATCTTGCGTCTAATGCCCAAGAG
AGACTGCATATGTCAGTCTATGCAGTCTCTTCTCAATACCATTGCATGTGTTTTCTCGGAATGCATTATCCGGTTATAGTTCATGATGTGCATTATCTTGCCATTTTAACCTCGGAAACT
GAGACATGTTAACTTTAAGAAGATTTGACATATTGAAGCTGTAGCTACTGCAGGTCAAATGATAAAGGATAGCAAGTTGATATTTAACAATTCTATACTGGTTTTCCTTCTTTCTCTTGG
TGCTTTCTATTCAAGTTTTCATATTTGATGTCTCCCAGGGTGCATACACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAG
ACTCTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATGAATGGCTGGGCTGAAAATCTCAAAGCAAAAGATGCT
GTAAGTTACTAATTTTGAAACCCAATTCTTTGCTTCTAGAGAT
GAACTACTGTGTCTGGCTTACGTATTTTCTTCATCCAAATATCCTTTTGGCAGTCTTTTCTCTCTTAAATGAATTATGAATGGTTTTGGAATGTTTGAGTTGGGTGTTGAGTTCCTTGAC
TCATCTTTTTGATAATTTCTTGAGGAAAAATTTGTTGATTGTTGTGAGGATTTCTGGTATTGCCTCACATTTCTTCCTGCAACTTGTAGAACATCAATACGAGGTTATTTTCTTTTGTTT
TTATTTTCTTCAAGAGGATGACTCTCCTTTATGTCACAACGTTCCATTTGCAAAACTGTAAATGCATGTTGTTAGGACATGCAGTGATCACAATCAGAGGTGAAATGGCAGTAGAGCAGC
TAGAATACTTACCTCAGTTTTATTATTAGTGCCATCTTTAAAGAAAGTGTACTACTACAGAAGTTTTCTTGGGCAAAACAATCCATTTCCAGAGATGCAAATGAGGCTTCTTTTTTTAGA
GTATGTGTGTGACACTGTGAAGGAATGTGGTTCATGTATGCACAACAAGCAAAGCTTGATTTTTACCTTGTTTGTGAACTTCTGTCATCTCTGCCTCCCCACATTTTAAAGTGAAAGAAG
GCTCTGACATGAGCTTGTGCTTGTTTTTCTTAATCATAAAAGATCGAATTCTATGGGGATTTTGATGCTAGCTTCCATAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGCTT
GGACTTCGCTCTGAAAG
GTATGCCCTAGGCCCTAATAAGTTAATATTGGACATCAAACACCTCCTTGAATCTCCTTCCGTCATTTTTACCTTTGGACCATCACTTTATGGATGAAATGCC
TAATTAAATGATCAGTTTGTCCTTGGATCTACTCTTTTTTTTTGGGTAATCAAATGGTTGCTCTGGTGTAGATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGGAA
GAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTATTCTGGGACAGATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCCGTCCTCGGCGGCCTATGGACGGGCGCGGCCAGGACCTACGCCTCGGTCGCCGTCGGCGGCGACATCGTCTCCGCGGCGCCGGGC
GTCTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTGTCAAGGATATCTTCGAG
GGCAAGAAGGTGGTGATTTTCGGACTCCCGGGTGCATAC
ACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAGACTCTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATGAATGGC
TGGGCTGAAAATCTCAAAGCAAAAGATGCT
ATCGAATTCTATGGGGATTTTGATGCTAGCTTCCATAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGCTTGGACTTCGCTCT
GAAAG
ATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGGAAGAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTATTCTGGGACAGATATGA

Retrieve as FASTA