Entry information : EgrKat02 ( Eucgr.F01777 / Egrandis_v1_0.050050m)
Entry ID 10158
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2016-01-17 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-17 (Christophe Dunand)
Peroxidase information: EgrKat02 ( Eucgr.F01777 / Egrandis_v1_0.050050m)
Name (synonym) EgrKat02 ( Eucgr.F01777 / Egrandis_v1_0.050050m)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrKat02
start..stop
S start..stop
EglKat02 1021 0 1..492 1..492
EguKat02 1016 0 1..492 1..492
PpeKat01 954 0 1..492 1..492
SalpKat1 951 0 1..492 1..492
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23086093..23086107 15 N° 2 23086442..23086538 97 N° 3 23087066..23087343 278 N° 4 23087693..23088469 777
N° 5 23088676..23088765 90 N° 6 23089286..23089353 68 N° 7 23089428..23089521 94 N° 8 23089665..23089724 60
join(23086093..23086107,23086442..23086538,23087066..23087343,23087693..23088469 ,23088676..23088765,23089286..23089353,23089428..23089521,23089665..23089724)


exon

Literature and cross-references EgrKat02 ( Eucgr.F01777 / Egrandis_v1_0.050050m)
DNA ref. Phytozome 12:   scaffold_6 (23085669..23089724)
Protein sequence: EgrKat02 ( Eucgr.F01777 / Egrandis_v1_0.050050m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492
PWM (Da):   %s   56679.22  
PI (pH):   %s   6.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTRGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLNESGKAHYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATKDLYDSIAAGNYPEWQLYIQVIDPDHEDKFDFDPLDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTADKSLGQKIASCLNVRPSM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_6, 8 introns). Incorrect prediction from phytozome (2 extra exon in 5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCCGTACAAGGTATCGATTGGCCCTTTTCCCCTTTCCCGCTTCGAATCGTCGGATCTTCCGATCTTCGCGGGCGGTGAAATTCTTTTTGTCCCTTACGTTTTGCGATACTTCTGA
TGGGGCTGATCTTCGCTGATCGAGCGGGAATTTTCAAGTTTTTTCGCGTCTGTAAAGCTCGATTCGTTTCCTAGTTTCCGAGAACTTGGAGAAAGAGTACTCCCTGTTGGGATCCATTAG
GGAATTGTTCGTGCTAGGGCTCTGTTTCGTCGATCGTCGGATCTTTATCAATCGCACATGACCGTTGCTAAATTGTTGATGTTTCCGCTGCGAATTGTGGATGTCGCAGTATCGTCCGTC
GAGCGCTCACGATTCCAGCTTCTGGACGACCAACTCCGGCGCCCCTGTCTGGAACAATAACGCATCCCTGACGGTTGGAACTAGAG
GTACGATTACCTCTACGGATCTCAGAGCTGTTTT
CTTTACCAAAAGATATGTAATTCTACGCTAGTTGCACTTCAAAGGGGGCGTTTGTTAAACTTTTGCTTTTAATGGTTATGACATGGGAAATTGCTAGGCCAAGCACTTTTTGCATTCTTG
CTAAAGTGTCATGGCACAGGAGTGGAGTACGAGATTTTGCGAGAGCTAACATGTCTATGGTCCATGCAAACCTCTTGAGGCCTAGATTGATCAAGCTGACAATGCATAGAAAAATATGAT
AGAAAATGCAGTAATTTTTATTTCACAATCCAGAGGCACAGTCGTGGACACTCAGCTACCTGTCCTGCAAATGAACTGGTTCAGTGCAGGCCTCTTTGGCCTATGTATGTGTCCCTCACC
CAAAACAGAAAAATGTTAACAGTAATTTAGCTTATCTCGGAGGCATACTTTTTGTTATCCTTAAGCTTTCCGAACATATTTGTCAAGATACAAAGCTTAACAGCATTTAAACGAAATTTT
CTTTTATTTACAGGTCCTGTTCTCCTCGAGGATTATCATCTATTGGAGAAAATTGCCAATTTCGATAGAGAGAGAATACCTGAGCGGGTGGTCCATGCCAGGGGAGCGAGCGCAAAAGGA
TTTTTCGAGGTCACTCACGATATCTCTCAGTTGACATGTGCTGATTTTCTTCGGGCTCCAGGAGTTCAGACACCTGTAATTGTCCGTTTCTCCACTGTCATCCATGAGCGTGGCAGCCCT
GAAACCCTTAGGGACCCTCGAGGTTTTGCAGTAAAGTTTTACACCAGAGAG
GTATGAGATGATTGCATGTTTTAGAATCTGCAAATTTATTCTTTTCATCTTCGTTTGTTGACCAGAAGT
GTATTTAGTTTACCGATGATCCAGATACAGTGTAGAATTCAGTAGAGTGTTGGTGTCTGTGCTTTAAATCCATGCAGTTCTTAACCATGTGATGATGGATTTTATCTTGACACTTCAACA
TGATTAGTTGAAGATGACTTTATCAAAGAGCTGTAATACAAAATTTTATTTCAATTACAAGAGAAGTCAGAACATCAAAATAGAATTAGTGTTTCTTCACGTAATTGTGTGGTTTCTCAT
TTTTCTTCTTTTCTTTGACCATTTGTTTTTCTGAATGCAGGGAAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTTTTTGTTCGCGATGGTATGAAATTTCCAGACATGGTCCATGC
TCTTAAACCCAACCCGAAGTCTCACATCCAGGAGAACTGGAGAATAGTTGACTTCTTCTCCCACCATCCTGAGAGTTTGCACATGTTTTCCTTCCTCTTCGATGACGTTGGTGTTCCTCA
AGACTACAGACACATGGAAGGATTTGGGGTTAATACTTACACCTTACTTAACGAGTCTGGAAAGGCACATTATGTGAAATTTCACTGGAAACCAACTTGTGGAGTGAAGTCTTTGCTGGA
GGAGGAGGCAATACGTGTTGGAGGATCAAATCACAGTCATGCGACTAAGGATCTTTATGACTCGATTGCTGCTGGCAATTACCCAGAGTGGCAACTCTACATCCAAGTTATAGATCCTGA
TCATGAAGACAAATTTGACTTTGATCCACTTGATGTGACAAAAATATGGCCTGAGGACATCGTGCCTCTGCAACCAGTAGGCCGCTTGGTGTTGAATAAGAACATCGATAACTTCTTTGC
GGAAAATGAACAACTAGCATTTTGCCCTGCAATTGTGGTCCCTGGTGTCTATTACTCTGATGATAAGCTGCTCCAAAGTCGGATTTTCTCCTATGCTGATACTCAGAGACACCGCCTTGG
ACCAAATTATCTTCAACTCCCTGTTAATGCTCCTAAGTGCACTCATCACAACAATCACCATGAAGGTTTAATGAATTTCATGCACAGGGATGAAGAG
GTAATGATCTTTATTTTCTGTTT
GCTTGATAGCGGGCTGGGAACAAATATGCCACAAGCATGACCTAATAACATATTCTTAGCTGGTTGTAATTGAATTGGCTACAGTAGCCTATCGATGCAACTGACCCGGTCGAATCAGTT
TGTTTTTATTTTTTTTTAAATGAGGAACTAATGATGTGGTGTATCCATGATGCTGATTTGTAGGTAAATTATTTCCCTTCAAGGTTTGATTCTGTTCGTCATGCAGAAAAGTTTCCCATA
CCTCCTCCAGTCTTGAATGGAAAGCGAGATAGG
GTAAGTTTCTGGGCCTACCTTGTGCATTTATATCAACATTGACTCTTAAAACATGGGCCCGCCTCTAGGAGAAATAATTAACACTTG
CGTTGAAGTTGTACATTACGATAGTTAATCTGTGGCAAGTTGAAAGGCATTGTGGTGCTGCTGTTTTCTGTTTGGACTTTGGATAAAATTGATTTAACTCAAATTCCATTGTGCTGGTGC
AATGATCCTGGTGATATCATCCAGCACATTTTCTTCTGCTAGTCTCTCATGTACAAAATTGCCTTTGAGATCGTCCCTACTTGTCCTCAGGGCAATGACAACTCCTTAAAACGACCACTT
TATTGAAATGAGGGGGAGTGTAGTAGCTCCGCTGAATTTTTAGACTAAGCTTAAAACTAAGAAAAGAAGGAGCAAGATGTTATAACTAGAAAAGAGATTCTCTGGCTAAAAAAATGAATT
TCTTGGGGTTTGCCTTGGATTGGATATTTCTGCTGCTGGTATTCATCTCTATGTGAACTTACTGATCATGCAGTGCATGATTGAGAAGGAGAACAACTTTAAGCAACCGGGAGAGAGATA
TCGATCCTGGGCACCGGACAG
GTACCTTTCAACCATTGTCTCCCGAGTAGATGTGTAATTTACTGGTCGCTCATGTGTTTCAAATTTGTCGCCAGGCAAGAGCGGTTTATTGGCCGCTGG
GTTGAGGCATTATCTGATCCCCGGGTTACCCAGGAGATCCGCTCCATCTGGATCTCTTACTGGACTCAG
GTAAGCTATAAGTATTCACCCCTTTTGCTTTATCCAATGCTACCACAATTT
GTTTAGTGTTGTTACCTGGAAATTGAGAACGTCTGTCTAGAACATGCTCAAATGATCATATGCTGATGGCCTACGATGCATTTTTGCTACAGGCTGACAAATCGCTTGGTCAGAAGATAG
CTTCTTGCCTCAATGTGCGGCCAAGCATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCCGTACAAGTATCGTCCGTCGAGCGCTCACGATTCCAGCTTCTGGACGACCAACTCCGGCGCCCCTGTCTGGAACAATAACGCATCCCTGACGGTTGGAACTAGAGGTCCTGTT
CTCCTCGAGGATTATCATCTATTGGAGAAAATTGCCAATTTCGATAGAGAGAGAATACCTGAGCGGGTGGTCCATGCCAGGGGAGCGAGCGCAAAAGGATTTTTCGAGGTCACTCACGAT
ATCTCTCAGTTGACATGTGCTGATTTTCTTCGGGCTCCAGGAGTTCAGACACCTGTAATTGTCCGTTTCTCCACTGTCATCCATGAGCGTGGCAGCCCTGAAACCCTTAGGGACCCTCGA
GGTTTTGCAGTAAAGTTTTACACCAGAGAG
GGAAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTTTTTGTTCGCGATGGTATGAAATTTCCAGACATGGTCCATGCTCTTAAACCC
AACCCGAAGTCTCACATCCAGGAGAACTGGAGAATAGTTGACTTCTTCTCCCACCATCCTGAGAGTTTGCACATGTTTTCCTTCCTCTTCGATGACGTTGGTGTTCCTCAAGACTACAGA
CACATGGAAGGATTTGGGGTTAATACTTACACCTTACTTAACGAGTCTGGAAAGGCACATTATGTGAAATTTCACTGGAAACCAACTTGTGGAGTGAAGTCTTTGCTGGAGGAGGAGGCA
ATACGTGTTGGAGGATCAAATCACAGTCATGCGACTAAGGATCTTTATGACTCGATTGCTGCTGGCAATTACCCAGAGTGGCAACTCTACATCCAAGTTATAGATCCTGATCATGAAGAC
AAATTTGACTTTGATCCACTTGATGTGACAAAAATATGGCCTGAGGACATCGTGCCTCTGCAACCAGTAGGCCGCTTGGTGTTGAATAAGAACATCGATAACTTCTTTGCGGAAAATGAA
CAACTAGCATTTTGCCCTGCAATTGTGGTCCCTGGTGTCTATTACTCTGATGATAAGCTGCTCCAAAGTCGGATTTTCTCCTATGCTGATACTCAGAGACACCGCCTTGGACCAAATTAT
CTTCAACTCCCTGTTAATGCTCCTAAGTGCACTCATCACAACAATCACCATGAAGGTTTAATGAATTTCATGCACAGGGATGAAGAG
GTAAATTATTTCCCTTCAAGGTTTGATTCTGTT
CGTCATGCAGAAAAGTTTCCCATACCTCCTCCAGTCTTGAATGGAAAGCGAGATAGG
TGCATGATTGAGAAGGAGAACAACTTTAAGCAACCGGGAGAGAGATATCGATCCTGGGCACCG
GACAG
GCAAGAGCGGTTTATTGGCCGCTGGGTTGAGGCATTATCTGATCCCCGGGTTACCCAGGAGATCCGCTCCATCTGGATCTCTTACTGGACTCAGGCTGACAAATCGCTTGGTCAG
AAGATAGCTTCTTGCCTCAATGTGCGGCCAAGCATGTGA

Retrieve as FASTA