Entry information : EgrGPx06 ( Eucgr.E00579 / Egrandis_v1_0.024172m)
Entry ID 10165
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EgrGPx06 ( Eucgr.E00579 / Egrandis_v1_0.024172m)
Name (synonym) EgrGPx06 ( Eucgr.E00579 / Egrandis_v1_0.024172m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrGPx06
start..stop
S start..stop
EguGPx06 502 0 1..250 1..250
EglGPx06 405 2e-145 1..250 1..249
EgrGPx07 387 4e-138 1..250 1..244
EcamGPx06 375 2e-134 1..185 1..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5521846..5522139 294 N° 2 5522884..5522960 77 N° 3 5523169..5523230 62 N° 4 5523402..5523520 119
N° 5 5523697..5523864 168 N° 6 5523956..5523988 33  
join(5521846..5522139,5522884..5522960,5523169..5523230,5523402..5523520,5523697 ..5523864,5523956..5523988)


exon

Literature and cross-references EgrGPx06 ( Eucgr.E00579 / Egrandis_v1_0.024172m)
DNA ref. Phytozome 11:   scaffold_5 (5521846..5523988)
Protein sequence: EgrGPx06 ( Eucgr.E00579 / Egrandis_v1_0.024172m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27224  
PI (pH):   %s   9.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCSSTKALLLRCRNLRAPLASSSPSSSALPFPIPFSPSVAEQTLLSPRPISSLPAPGPPIKPPPPFGCRSFVSRDRRSSRAMASQSSKGSIYDFTVKDARGNDVDLGSYKGKVLLIVNVASQCGLTNSNYTELSQVYEKYKNGLEILAFPCNQFGAQEPGTNEQIVEFACTRFKAEYPIFDVDVNGENADPLYKFLKSSKGGLFGDNIKWNFSKFLIDKEGNVVDRYAPTTSPLSIEKDIKKLLGVA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_5, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGCTCCTCTACAAAAGCTCTGCTCCTCCGCTGCAGAAATCTCCGCGCCCCTCTCGCCTCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTC
GCTGAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCGCGCCCGGCCCGCCGATCAAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGC
CGTGCCATGGCGAGTCAGTCCTCGAAGGGTTCGATTTACGACTTCACCGTCAAG
GTCGGTTCTCTCTCGAGGTTTCCCTTTTGTGATTTCGCGGGGGAACTGTGAATCGGGAGTCGCCCA
TCACCAGAAATGTCGACCCATATAATAAAGTTCGCCTTCTTTTTTTTTTCAAGTCATTTCTGAGCGAAGATTTTGTTTTTTTATATCCACAGCGACGCTTCGATTTTATGTAACTCAGAA
AGATGAAATTTTTATTCAATTGGTGTCGAGACTTTCTTGTAATCTATGTAAAGCTGAGGCCTTTTTCCAAAGCCCCGTATCAGAAATGTTAACCTCTATTATAAAGTTCGCCTTTCTTTT
TCTTTTTTTGGGTCATTTCTGAGCGAAGATTTTGTTTTTTTATATTCACAGCGACGCTTCGATTTTTCTAGCTCAGAAAGATGACATTTTTATTGAATTGGTGTCGAGACTTTCTTGTAA
TCTATGTAAAGCTGAGGCCTTCCAAAGTTCTTTCTGTAGCCTTGTTTTTGGAGGTTTTTGAAAGTTTAGGTGGTAATCTGAAAATGGACCAATCTACAGCACCTTTGATGTATAAGTTTC
CCTTTTATCTATGTAATTCGCTCAAATATCGGATTTTGTTGATTCAAATATCGAGTTTTGAGTAAGTTGTTGGGGTAAGTTGGTCAGGGAGCGAGATCATGTGTGTCGTGCCGTGTGCTG
AGAGGTTGTGAATCATTTGAGGACCATGATGTTATGCTGTGCTGAGACTTGGAGATTCGGGTTCCTTTTTTTATTCAGGATGCTCGAGGAAATGATGTCGATCTCGGTTCCTACAAGGGC
AAGGTCTTGCTGATTGTCAACGTCGCTTCGCAGTG
GTAATTCTCAGGATTGTGTTTATGCCCCGTAACAGGGAACATCTGGTTGGACTTTAATCTTGGCCGATCTGGTTAAAAGCAATAT
CATATTTCATGCCTTTTATCATTTGGAATTCTTTATGCAATTCAGCTTGGGAGTAGCTCAGTGTTTTAGTAATCGGGTTGGTCCACCATGTTCTAATTTTTTTTATCGGTATGTTTGTTG
CAGTGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAGGTCTCCTATGCCTCCCCTGATGCCCCATAGTATCTTGTGTTTTAGTGGAATCCTG
GCCTTAACAGGATAATAAAGATATATCGTATCAGAAAAAGCAGTTGGTTATTGGTATCACTTAGCATATGGAGATTCTAGAAAATTTAAAGAGGATGTCACTCTGATGTGATGCAGGGTT
GGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAGCCGGGGACAAATGAGCAGATCGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAG
GTAAA
AGATATACATGAGGTCCTTCTCTGAAGATGAAGAGCATATGGTGAACTATCTCTCAAGAGTTTTTTGGAGTCGTATCTGCAGTTCCCTTATATTTCCTAGCAACTGGCAATTTGCAGTTT
GAATTTAAAAAAAAAAAGTGAGGATGAAGAATCTGATTGCTTTTTCTATAGGTTGATGTGAATGGTGAAAATGCTGATCCTCTTTACAAGTTCCTGAAATCAAGCAAGGGCGGACTCTTT
GGGGATAACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTCGATCGCTATGCACCCACTACTTCTCCTCTTAGCATCGAG
GTGAGAGTCTACTCTTTGATG
ATCATAGTCGAAGTTTGTTGACTTTTTTTTTGGCTATTTGACTGAGGCATTGCGGTTGTTATTGTCGCAGAAGGACATCAAGAAACTGTTGGGAGTGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGCTCCTCTACAAAAGCTCTGCTCCTCCGCTGCAGAAATCTCCGCGCCCCTCTCGCCTCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTC
GCTGAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCGCGCCCGGCCCGCCGATCAAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGC
CGTGCCATGGCGAGTCAGTCCTCGAAGGGTTCGATTTACGACTTCACCGTCAAG
GATGCTCGAGGAAATGATGTCGATCTCGGTTCCTACAAGGGCAAGGTCTTGCTGATTGTCAACGTC
GCTTCGCAGTG
TGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAGGGTTGGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAG
CCGGGGACAAATGAGCAGATCGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAG
GTTGATGTGAATGGTGAAAATGCTGATCCTCTTTACAAGTTCCTGAAA
TCAAGCAAGGGCGGACTCTTTGGGGATAACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTCGATCGCTATGCACCCACTACTTCTCCTCTTAGCATCGAG
AAGGACATCAAGAAACTGTTGGGAGTGGCATGA

Retrieve as FASTA