Entry information : EgrGPx05 ( Eucgr.D01857 / Egrandis_v1_0.029181m)
Entry ID 10167
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-14 (Christophe Dunand)
Peroxidase information: EgrGPx05 ( Eucgr.D01857 / Egrandis_v1_0.029181m)
Name (synonym) EgrGPx05 ( Eucgr.D01857 / Egrandis_v1_0.029181m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2006]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrGPx05
start..stop
S start..stop
EguGPx05 346 2e-124 1..168 1..168
EcamGPx05 329 7e-118 1..165 1..165
EgrGPx06 306 8e-108 1..167 83..249
EguGPx06 305 3e-107 1..167 83..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32595702..32595749 48 N° 2 32595012..32595088 77 N° 3 32594664..32594725 62 N° 4 32594050..32594168 119
N° 5 32593672..32593839 168 N° 6 32593545..32593577 33  
complement(join(32593545..32593577,32593672..32593839,32594050..32594168,3259466 4..32594725,32595012..32595088,32595702..32595749))


exon

Literature and cross-references EgrGPx05 ( Eucgr.D01857 / Egrandis_v1_0.029181m)
DNA ref. Phytozome 11:   scaffold_4 (32595749..32593545)
Protein sequence: EgrGPx05 ( Eucgr.D01857 / Egrandis_v1_0.029181m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18636.42  
PI (pH):   %s   9.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQSQKASVHDFTVKDARGNDVNLSQYRGKVLLIVNVASQCGLTNSNYTELSKLYEKYRNGLEILAFPCNQFGSQEPGTNEQIQEFACTRFKAEYPVFSVDVNGANADPLYKHLKSSKGGFFGDGIKWNFSKFLVDKEGNVVNRYAPTTSPLSFEKDVKKLLGVE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_4, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAATCCCAGAAAGCCTCGGTTCACGACTTCACCGTCAAGGTCTGGGTTTTGGCCGGTTTTCTTAATAACTCGTAAAGGTCTCGCCTTTTTCGTGTTTTCCCTGTGGATGCG
TGAGAGGGCTTGGGTCGGTTATCTTGATAACTCGTAAATGTCTCGCCTTTTTCGTGTTTTCCCTGTAGATGCGTGAGAGGGCATGGGTCGGTTTTCTTAATAACTCGTAAAGGTCTCGCC
TTTTCCGTGTTTTCCCTGCGGGATGCGTGAGAGGGCTTGGGCCGGTTTTCTTAATTAACTCGTAAAGGTCTCGCCTTTGTCGTTTTGTGGGATTAGTCGGGCCAAAAGTTCGTGTGCTGG
ATTTATAAAGTGAAACGAAAGTAGGAATTTCTGTAGAACTTGTAGACATGATCTTCTGATAAGTACCCTTTTCAAATTTGTATTAGATGTTTGAGGAAGAGAAATAGGTGGGTTTGGCGA
AGTTTTAGTGAAATTGGTCGTGCTCAGTTCGTAGCGCAAACTGCAATAGCATTTTCGCCTTGAGTCATATTACCGTTGAGTTTGTGTTTGTTAATCAAGTTTGTTCCATGTAACCACAAA
TTGGTTTTTTCGCGATCCTTAATGTGACTTTCTGTTTATTCCATGTTTGCTTTTGTTGTAGGATGCAAGGGGGAATGATGTCAATCTCAGCCAGTACAGGGGGAAAGTCCTGCTGATCGT
CAATGTTGCATCGCAATG
GTAATTGTTTGATTGATGTTCAATATTCCTTTTTGGTCTAAGATTAATGAGAACATATCTCACCATATTTACGTTCCTGTCCGTGTGGAATAGATTTAGTGC
AAGTGCCAATTTTGTGTTTCTGTTCTTTTATCCCGGGTGCTTCAAAAATCTGTATGATCATTTCAACAGATGACAATTGACCAACAAAGTTTCATGAGCAAGCTGTGGCCTGCCAAATGA
TTTCCTTTGATTTGAGATTCTGGTTAAGATTCTTACTGGTGCGTGCTTGCTTGTTGTGATGCAGTGGCTTGACAAACTCAAACTACACAGAGCTGAGTAAGCTTTATGAGAAGTACAGAA
ATCAAG
GTATGTTAGTTTTGTTTCTCCCTCTTCGCACAATTTGAATTAGCTCCGATGCACTAGACAGTGATGGCTCAGACCAAGCTATTACACTGGTCCCAATGTAGCTGTTATTTTTCC
CGGGAGGAGGACTAATTGCTGTCTTCTTTCCTTATGGTTCCTTCATGGAATGAGTTCATGGAACATTGTAATTTTAGTGAAATTAGGACTTCTGCAGTGAATGAATGCACATTTGGCGTC
CTTTGTTATAAATTGTGAAGCACAGTAGAAGTGGCCCAACGGAGTAAAGGATTTGCAGTCACTTTTGTTCCCTGACAGATCTTCCATTATTACTTTGATATGGAGCAGTCACATGTCGAT
CTATTCAACCTTCCGCATCAGACCCAACAATGTCTTACTTTTGTCTAACAATTCATTACCCTGGAGTATCAATGGTTTGCACAAATGAAATTTGGGTGGGAAGATGTAAGAAGATGACTC
TATTCCCTTACTGCAATACAGGTCTGGAGATTCTGGCTTTTCCATGCAACCAATTCGGATCTCAGGAACCAGGGACCAACGAGCAGATCCAAGAATTTGCCTGTACTCGATTTAAGGCTG
AATACCCCGTCTTTTCTAAG
GTAAATTTTTTTATTTGTTTTTGTTTTCTTGGTAGAAGCTTCTGTCACGATGCTGGATCCAACTCCAACATGGTACGGTAGAACTGCTTACGACTAGGAT
CTTAATCATACAAATAACTAGATAGACATTGTGGATTTTTAAACCTTCTTCTCTCTCTCATTACTGGTGAGCAAGATAGTAACAACATTATATGCGTGCACTTTATACAGGTTGATGTGA
ATGGTGCTAATGCTGATCCATTGTATAAACACCTGAAATCTAGCAAAGGCGGGTTCTTTGGTGATGGCATCAAGTGGAACTTCTCCAAGTTCCTGGTCGACAAAGAGGGGAATGTGGTCA
ATCGTTACGCTCCAACAACTTCACCCCTAAGTTTTGAG
GTAAAAGTAACTGAGCGCTTGTTTCACGTGCCATATATTCCTAATCCTTAAGTTCATTTCTGAGTAATGCCGACTGTTTCCC
TTGTGATTGCAGAAGGATGTGAAGAAACTGCTGGGAGTCGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAATCCCAGAAAGCCTCGGTTCACGACTTCACCGTCAAGGATGCAAGGGGGAATGATGTCAATCTCAGCCAGTACAGGGGGAAAGTCCTGCTGATCGTCAATGTTGCATCG
CAATG
TGGCTTGACAAACTCAAACTACACAGAGCTGAGTAAGCTTTATGAGAAGTACAGAAATCAAGGTCTGGAGATTCTGGCTTTTCCATGCAACCAATTCGGATCTCAGGAACCAGGG
ACCAACGAGCAGATCCAAGAATTTGCCTGTACTCGATTTAAGGCTGAATACCCCGTCTTTTCTAAG
GTTGATGTGAATGGTGCTAATGCTGATCCATTGTATAAACACCTGAAATCTAGC
AAAGGCGGGTTCTTTGGTGATGGCATCAAGTGGAACTTCTCCAAGTTCCTGGTCGACAAAGAGGGGAATGTGGTCAATCGTTACGCTCCAACAACTTCACCCCTAAGTTTTGAG
AAGGAT
GTGAAGAAACTGCTGGGAGTCGAGTGA

Retrieve as FASTA