Entry information : EgrGPx09 ( Eucgr.K03389 / Egrandis_v1_0.029066m)
Entry ID 10170
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-19 (Christophe Dunand)
Peroxidase information: EgrGPx09 ( Eucgr.K03389 / Egrandis_v1_0.029066m)
Name (synonym) EgrGPx09 ( Eucgr.K03389 / Egrandis_v1_0.029066m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrGPx09
start..stop
S start..stop
EguGPx09 346 1e-124 1..170 1..170
EglGPx09 328 9e-118 1..161 1..161
EcamGPx09 319 4e-114 1..160 1..160
NtGPx05-1B 304 6e-108 1..170 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42777072..42777125 54 N° 2 42776906..42776982 77 N° 3 42776722..42776783 62 N° 4 42776174..42776292 119
N° 5 42774976..42775143 168 N° 6 42774818..42774850 33  
complement(join(42774818..42774850,42774976..42775143,42776174..42776292,4277672 2..42776783,42776906..42776982,42777072..42777125))


exon

Literature and cross-references EgrGPx09 ( Eucgr.K03389 / Egrandis_v1_0.029066m)
DNA ref. Phytozome 11:   scaffold_11 (42777125..42774818)
Protein sequence: EgrGPx09 ( Eucgr.K03389 / Egrandis_v1_0.029066m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18845.68  
PI (pH):   %s   9.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASQSVPEKSIHEFNVKDSRGKDVDLSTYKGKVLLVVNVASKCGFTNSNYTQLTELYNKYKDGLEILAFPCNQFLKQEPGTSQETQEFACTRFKAEYPIFHVRVNGPDTAPVYKFLKASKSGFLGSGIKWNFTKFLVDKEGHVISRYGTTTSPLAIEAEIKKALGEA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_11, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCTTCGCAGTCGGTCCCCGAGAAATCAATCCACGAGTTCAACGTCAAGGTAAAATACCAGAAACTAACCTTTCTCTGCACTTGCGGTGATGGTGAAGATGACAGACTAATGAGG
TTTATGGGTTATGGTGGGAGCAGGACAGTAGAGGGAAGGACGTTGACTTGAGTACGTACAAAGGGAAGGTCCTCCTCGTTGTTAACGTTGCCTCCAAATGGTATGTCTCTTGCCAATCCC
CTATTTCAGATGGGTTTTTCCTTCGGAATTTTTTTTCTTTTTTTTTGGCTTGTTCTTGTGGAATGAATTTGTTTTTGTTGTTGTTGATTGGTTTGGAAACAGTGGATTCACGAATTCCAA
CTATACACAGCTCACTGAACTTTACAACAAATACAAAGACCAAG
GTTGGTTGTTTTTTTTCCCCCCTTATTTTCCTGTTCTTTTCCTTTTAAGCTTTTGGGTCTACTCCGTTTGGCAAAT
TTTTATAGGTTCGATGATAATTTTTTTGGTGATGTGCTGATGTCTGGGATTTTGCGTGCAAACGGTTACTTTGCTGATGAATTGAGATGTATCGGATGGAGGAAGTTTTAGAAACTGGCA
TCAATTGGTTAATTGATGCTGAGGATTTTATCTAATTTTTTTTTTAAACTTCATGGATTCTTCGATTTCTTGAGTTCCTTAATGAATTTCAAGGGAGTCATCGTGTATTTTTTCTTTTAG
GGGACTAAGTTGTTGCGTTGTGGATTTGCTGCAAATGAAAAGTTGAGTTGTTGTTATATCCCTTGCTTATCATAGAATTCCTTAGAGTACTTGGGTGTTGTTGGGTGCCTCAGGTCTTGA
GATCTTGGCTTTTCCGTGCAACCAATTTTTGAAACAAGAACCTGGAACAAGTCAGGAGACACAAGAATTTGCATGTACAAGATTCAAAGCTGAATACCCGATCTTCCACAAG
GTAAGAAT
TGCTGCTCTGCAATCTTACACTTTTAGTAGCTTCGAGTTGTGAGTGATGTGGACAACTGTTTCTATATTGTGTCACAATACGACTTTGGCAAAAAATAGTTAACCTTGCAAACTTATGAT
TGTCTGCCACTTCATCCTGTACAGATGCATGAGTAAAATCTTATGTGCTGCTGCCACTACGATGTGGATTTTCTTGTTTGTATATGTTTGCCAAAGTTTACCGTTGGCCTGAGGAAAATT
GATTTTTATTTGACTTGGTCTCCTTTGCGTTTAAATGCAACTAACTGTTATCTTTTTATAGGTATGCTCTTAGCTAAATCTTTGTAGTAAATACTATGACAACCCTGAACCATAAGCATT
CAAATCATGGTCCCTGACTTGGGTAACTTTTTCAGGAGTTTGTTGGCTGGTCCTTGACTCAAATTAATTAAAAGCTAGACGAATGTAATGACACTTGCTTAACACAGCAAACATTGCTTC
TTTGAATGTGAGCTGACGGTAGAGACAACATTTATTGTATTGATGATACTTGCTCTCTTGAAATCTATTATGGTAGGTAAACACGTCAGGTTTGGGTTGGAATATTTATTGGTGATAGGT
TAGGGTAAAAGTTCAAAGGAGTTGCAAACTTCAATCCATCAGATGTAAGGTATCAAAAGTTTGGTGTCCTACTCAAATGTGACCCCGAAATATTGTCTCTGGGGTAACATGTCCATCCTA
TGACATGTTAGCTTTGTTGGGAAAAACCTCAATTGATAGCTATTGTTATGTCCATCAATTCTAGATTTGCCTCTTTTTTTTCCTTCTGGTTTTCAGATTGGCATCACTTGACTGCTATAG
AATTTTCCTTCTTATTTTGCTCTATTTGTGATTATACTTGTTGACAATCTCTCTCATGTGCACCTATTATATATGTGATCTGTTAATAGGTATGTAGCTTTGATAGTGCTGAATCATCTA
GTTCCCTGACAACAGTTACTGCATCCAATTAGCCAATGTGTTAAGTTGCTGTTTGATTCTAGGTACGAGTCAATGGACCAGACACAGCACCAGTCTATAAGTTCCTCAAAGCAAGTAAAT
CAGGATTTTTGGGTTCAGGAATAAAATGGAACTTCACGAAGTTCCTCGTTGATAAGGAGGGGCATGTCATCAGTCGCTATGGCACAACCACCTCTCCTTTAGCCATTGAG
GTACTCTTTC
TTTCTCTCTTCACATAGATTCCCAGTTAGCAGATCATCTGCACACGTGCTTTTAGATCATTTTTCCTGGAAGAGAATTTATCACAGCCCTGTGACAAATAATACACGTAACGCAGGCGGA
GATAAAGAAGGCACTGGGGGAGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCTTCGCAGTCGGTCCCCGAGAAATCAATCCACGAGTTCAACGTCAAGGACAGTAGAGGGAAGGACGTTGACTTGAGTACGTACAAAGGGAAGGTCCTCCTCGTTGTTAACGTT
GCCTCCAAATG
TGGATTCACGAATTCCAACTATACACAGCTCACTGAACTTTACAACAAATACAAAGACCAAGGTCTTGAGATCTTGGCTTTTCCGTGCAACCAATTTTTGAAACAAGAA
CCTGGAACAAGTCAGGAGACACAAGAATTTGCATGTACAAGATTCAAAGCTGAATACCCGATCTTCCACAAG
GTACGAGTCAATGGACCAGACACAGCACCAGTCTATAAGTTCCTCAAA
GCAAGTAAATCAGGATTTTTGGGTTCAGGAATAAAATGGAACTTCACGAAGTTCCTCGTTGATAAGGAGGGGCATGTCATCAGTCGCTATGGCACAACCACCTCTCCTTTAGCCATTGAG
GCGGAGATAAAGAAGGCACTGGGGGAGGCATGA

Retrieve as FASTA