Entry information : EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Entry ID 10171
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Name (synonym) EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrGPx04
start..stop
S start..stop
EguGPx04 341 1e-122 1..170 1..170
EglGPx04 296 6e-105 17..160 1..144
VvGPx08 274 3e-96 1..170 1..170
LeGPx08 274 4e-96 1..167 1..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32590293..32590346 54 N° 2 32588991..32589067 77 N° 3 32588639..32588700 62 N° 4 32587683..32587801 119
N° 5 32587253..32587420 168 N° 6 32587065..32587097 33  
complement(join(32587065..32587097,32587253..32587420,32587683..32587801,3258863 9..32588700,32588991..32589067,32590293..32590346))


exon

Literature and cross-references EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
DNA ref. Phytozome 11:   scaffold_4 (32590346..32587065)
Protein sequence: EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19371.79  
PI (pH):   %s   4.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQLMQDPQPIYELAVKDEKGNDVSLGEYRGKVLLIVNVASKCGLTNSNYTELNQLYERYKDGLEILAFPCNQFGNEEPGTNNEIKEFVCTRFKSEFPIFDIEVNGDKEAPLYKFLKSGKWGMFKDDIQWNFAKFLVDQNGVIINRYYPTTSPLTIEGDMKKLLGIS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_4, 5 introns). Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAACTGATGCAGGACCCGCAACCAATTTACGAGCTCGCTGTCAAGGTTTGTCCCATGATTTCATCACCCACCTCAGAAATTTCAAACCTTTTCTGGATCTCTCCGTGATGT
TGGGTTCTTTCTTTGTCTGGCTTTGCGAGTCTGAATGTTTTCTGGGCACAAGCCCTTTCGCAACTAGCTTTGTGAAGCTTGTTCTTGAACCGAACTGTTTCGATGAAGAGCTTAATAGTG
GTGATGAGAATGTTCCCTTTTGGACGATCGGCCGTTTGTTTGGGATTCTTGAATCGGCCCGACTATTATTACTGTCGGAAACATTGAAAGATTGCATCTTTGGTGTGAATGGGTGATGAA
AAGCTAGTTGACTCTGTGTGGCAGTATTTGTTGGGAGCTAGCTGAATGTTCTCTGGTCACAAACTCTTTCGCAAGTTCACTAGCTTTTTCGCAAGTTCACTAGCTTTGTGAAGCTTGCTC
TGGAACCGAACTGTTTCGATAAAGAACTGAATAATGATGATGATAATGCTCCCTTTTGGTGGATCAGCCGTTTGTTTGGGATTCTTGAATCGGCCCGAGTGTGATTATTGTCGGAAACAT
TGAAAGATTGCATCTTTGACTTGAATGGGTGATGAAAAGCTAGTTGACTTTGCGTGGTGGTAGTTGTTGAGAGCTAGTTGAATGTTCTCTAGGCACAAACTCTCTCGCAAGTTCACTAGC
TTTGTGGAGCTCGTTCTTTGACCGAACTGTTTCGGTAAAGAGCTTAATAGAGGTGATGATAATGTCCCCTTTTGGAGGATCGGCCCATTTTTTTGGGATTCTTAAATTGGCCCAAGTATG
ATTATGTTGGAAACATTGAAAGATTGCATCTTTGATGTGAATGGGTGATGAAAAGCTAGTTGACTTTGCATGGCAGTAGTTGTTGAGAGCCAGAGGATACTTGATATATTATATTGAATC
ATTTTTGTTGTCGCTGGTGAGAAATGGTGGCGAAGAGATCAATTTTGGGGCCAACTGAATGGCAGGAGGTCCTTTTGTGCTTCTTTCCCTTTTCAGATGTTGCATTCTAAAAGGGTCTCT
TTTTAGCCTGTTCCTTCATTTTGATATGTATATTAAGAATTAGACATTTCGCAGTCTCTTCCTGCTGCACTAGTTCAATTGGGGTGACCTTTCTGGCATCTGACTGAAGATAATGTTTTT
CATTCCCCCATTATATGTGAACTTGATGGAGCTTCTTCAGGCAATAAATGTCTAAAGCTTTTAGTTCTTTAAAATGCAGGATGAGAAGGGAAATGATGTAAGTCTGGGTGAATATAGAGG
GAAGGTCTTGCTTATTGTGAATGTGGCCTCGAAATG
GTATGTACCTTATCCACCTTGTCTTTGTTCTGTCTCTTGTTACCAAAATTATACTGAGGAAAACAAATATGATAGTGGATCTGA
GGAAGAGAGATTTTGTCGAAATACGAAGAGAAGGGAGTGCATGGTGATTTTTGTTAGCGTGAACCTTTGAATTCGGAGATATTGTTATGGAGATGTGATGCATTTAATAGCTTAGTTTCG
TTTTACACTTCAAAAGCTCACCAAATGGATATTCTCTAGATTTTCCCTGTAAATATATTTACTCAATTGTCGTTTGGTTTTGGCAGTGGATTGACTAACTCAAACTATACCGAGCTAAAC
CAGTTGTATGAGAGGTACAAAGATAAAG
GTGAGCTCTTCAAACTCCACGTTTGAGTTCCCATCTTCCTTAGGTGACTAATCCACTAGGGCTGCAGAAGTTGGAATTTTAAAGTAATGGTT
TGTCAATTCTAATCCTTGGTATAAAACTATACTCTGGAGCATGGTGCTGAGGATGGAAAAGAGCTGGGGTACTACTTCACCGGTTGAGTGGATCTGAGTTTTTGTCATCAACCTTCGTGG
ACAAACCTCTCATTCTTTCCATCTTCCATTCTTTGGTTTTAAAACTGGTCGAAAACTTTCACAATGATCTCTTAACTTATGGTGCTCACTCTAGCTGTTATCATCTTAGGGATGATCTTA
TTGTAAGCATAGTCTTTATCAGCCACTCTCCAACACCTTTTCACATCACTACCAGTGTTATATTTTTTGTATGGCCTACACTTCTGATGCTCTGAAGATGAATGTTCTCCATCAACTTCT
TTAGATGAAGTATTCTCTTACTTTGTAGAGCTGGCTCTGGTAAAAAAATTCTAACCCGCTGATCTTGGAATGTGACATTTACTGCTAATATTTATGTCAGCAAGGGGAAAAAGGAATAGA
AAGATCAATACTCATATGTTTGGTCCTTCATTCTCACTTCATTGACCTAATATATATTTCTATTCTCCAATTTGCAATACTCCGTTTGCAAATTATGAGAATTTTTCTTGTGTTATCTCT
ATTTCCTTTCCAGTTTTACTATGCACATTTGATTTGTGACAGTACTAGATGTTTGGTGGCATAGAAATTGATTATCCTGAACCAGAATTGTGAGAAGGTAATGCTTGAGTGACATTGGGT
TTTCCTGATAAGTGAATTGGTGCAGGCTTGGAGATACTGGCCTTCCCATGCAATCAGTTTGGTAATGAGGAACCAGGAACAAACAATGAGATCAAGGAATTTGTTTGCACCCGCTTTAAG
TCAGAATTTCCCATCTTCGATAAG
GTCTACAGGCAATGTTTTTGGTCTCCTACTTTCTGAAAACCTTGTTTAGACACAAATTTAAGTTACAATGGCTTGACCGCCCCTAAGATGTAAATG
CCTCATTATATTCAAGATGCTGCTTGAACACTTAGTTTCCTTTGTTCGCATAATTATCACCACCAAAATCTTGAATAGTTTCTTTCTTTTCCAAATTCTGTATTTGTGGTCTGAGGTCTG
GTTCAGCAACAAGGAATGAACATGCGACTTCCTTTTCTTTTCTTAGATCGAAGTGAATGGGGACAAAGAAGCACCACTATATAAGTTCCTGAAATCAGGGAAATGGGGAATGTTCAAGGA
TGATATTCAGTGGAACTTTGCCAAGTTCCTGGTAGATCAGAATGGGGTGATTATAAATCGTTATTACCCAACGACATCTCCTCTTACCATTGAG
GTATACCTGCTTACAGATCATGTTTT
TCTCCAATTGATGCTTAGGGATCATGTGGTCTATATTTGATCACAAGTTGGTCTCCTAGATGTGCTTGAATAACGAAAACACTTTTATGTCCATTTACTAAACTAATGAAACAATGTCTG
TGGCTGCAGGGGGACATGAAGAAGCTGTTGGGAATTTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAACTGATGCAGGACCCGCAACCAATTTACGAGCTCGCTGTCAAGGATGAGAAGGGAAATGATGTAAGTCTGGGTGAATATAGAGGGAAGGTCTTGCTTATTGTGAATGTG
GCCTCGAAATG
TGGATTGACTAACTCAAACTATACCGAGCTAAACCAGTTGTATGAGAGGTACAAAGATAAAGGCTTGGAGATACTGGCCTTCCCATGCAATCAGTTTGGTAATGAGGAA
CCAGGAACAAACAATGAGATCAAGGAATTTGTTTGCACCCGCTTTAAGTCAGAATTTCCCATCTTCGATAAG
ATCGAAGTGAATGGGGACAAAGAAGCACCACTATATAAGTTCCTGAAA
TCAGGGAAATGGGGAATGTTCAAGGATGATATTCAGTGGAACTTTGCCAAGTTCCTGGTAGATCAGAATGGGGTGATTATAAATCGTTATTACCCAACGACATCTCCTCTTACCATTGAG
GGGGACATGAAGAAGCTGTTGGGAATTTCATGA

Retrieve as FASTA