Entry information : EgrGPx08 ( Eucgr.H01518 / Egrandis_v1_0.037963m)
Entry ID 10172
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: EgrGPx08 ( Eucgr.H01518 / Egrandis_v1_0.037963m)
Name (synonym) EgrGPx08 ( Eucgr.H01518 / Egrandis_v1_0.037963m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrGPx08
start..stop
S start..stop
EcamGPx08 345 2e-124 1..170 1..169
EglGPx08 342 4e-123 1..170 1..170
EguGPx08 338 2e-121 1..170 1..170
EguGPx09 272 2e-95 1..170 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18046525..18046578 54 N° 2 18046325..18046401 77 N° 3 18046149..18046210 62 N° 4 18045106..18045224 119
N° 5 18042507..18042674 168 N° 6 18042355..18042387 33  
complement(join(18042355..18042387,18042507..18042674,18045106..18045224,1804614 9..18046210,18046325..18046401,18046525..18046578))


exon

Literature and cross-references EgrGPx08 ( Eucgr.H01518 / Egrandis_v1_0.037963m)
DNA ref. Phytozome 11:   scaffold_8 (18046578..18042355)
Protein sequence: EgrGPx08 ( Eucgr.H01518 / Egrandis_v1_0.037963m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   19286.85  
PI (pH):   %s   8.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAQSADEKSLHQFVVKDSKGNEVNLSAYEGKVLLIVNVASKCGFTEQNYTQLAELHNRYKDGFEILAFPCNQFLRQEPDTSQEVEDFACNRYKVEFPIFQVCVNGQETAPLYKYLKARKTGFLGSRIKWNFTKFLVDKEGRVISRYGTITPPLAIEEDIQKALGMA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_8, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCCGCCCAATCCGCGGACGAGAAATCCCTCCACCAGTTCGTCGTCAAGGTGGGCGTGTCGCTGCGCGAATCGTTCGCGAATCTCTCTTTCACGGGCTCGAAATTTACGTGGAAT
CGCGATGTTTTGATGTTAATGCTGATGCTGATGATGATGATGATGATGATGATGCAGGACAGCAAGGGCAATGAGGTGAATCTCAGTGCTTACGAAGGGAAGGTTCTTCTCATCGTGAAC
GTTGCTTCCAAATG
GTCTCTCTCACCCACCTCTCTCTTCTCATCAATTTTCTTCCTTTTTTTTTTTAGTGATGCGTTCGCTCTCAAACTAACAAGATTGATCTGTGGGTGTTTTTGGGTT
TGAAACAGTGGGTTCACCGAACAGAACTACACGCAGCTCGCTGAACTTCACAATAGGTACAAGGATAAAGGTCGGTTCTTTCGCCATTTTCTGTTCGGTTGCATTTTGTTGCATTCATGG
ATGTCGTCTTTTGTTATAATGGGTATGTTTCCGTGGTGATTATCATGGGAATTCCTACATTTTTCGACCATGCAATGGAAGTAAGTATGGTGATGGGTGACTAGCACTATCAGTTGAGCT
TGTAAGTGGGGAAAGAAAACCATAGAAAGAAATACTGTATGTTTATGCCCCAAAAAATAGGAAAAATGCAAAATCAACCAGTGTTGGGGTACTCAAACATCTTCATGAGAAGCTAAATAG
CCTGGTGCTGTAAATGTTGGCCAAGTGATGCATAAATTGTCTTTATACTGCTTTTGTCCGAGGTATACTGTCCGATAAGATCATGAGGATGAATCGAGTCAAACCGAATTTTGTCTTCTA
CATTTATTAACCTACTGCTTTTTCCAATTTCTTTTTGTAACTGCTCCAATGCTTGATGATGCACTACTCTGCCTTGGCATCTTTGCTGGGGTTGCGGTCACTTCTAGGGGGTTGGCCATG
CATGCAAGTAAGAATCAGATAACTTGGGATGATCGAGTCAACCCAATTAATTGCAGATGCCAATTTTGAGCTTCATTTCCTTCTGGAAATCCCTATTCATTGTCAATCTGCAGAGCACTT
GTTCTTCGTCTAATGTTGCAATAATCTCTTTGCTTTGTTCATCGTCTGTTTGGAAATTTGTGAACATTCGTAATAATTTGTCCCTCATGCTGTGCATTGCCATGGAAAGTTCTTTCCACT
GGAAATTTTTAAATAGAGAGTAGTCATTTTCTATATTGATTATTCCACTGGAAATTTTTAACATGCACTGCCGACCTTTCCTTCTTAGCCCCTCCCAAGATGAGTTTAATGAGTTTGAAA
TTGAAGGGAATGGCTGCTCCTGGGTTTTTCTCAGGATTCGAAATCTTGGCATTTCCATGCAACCAATTTCTCAGACAAGAGCCAGACACTAGCCAGGAGGTGGAAGATTTTGCTTGTAAC
AGATACAAAGTCGAATTTCCAATTTTCCAGAAG
GTATGCTTTTTAGCTGCTCTCTCGCAACTGTTTAGCTTTTCAGATTGATCATTTGAATTGTTATTTTATCAACTAGGTCCATTTCTT
TGTATGTTCCCCTCCTCTTGTATTTTTCTGCCAGGCAGTTATATAGATTTCCAAGATCTCTTCTTTCTTTTCGGCTCTAATTGGTTGCTGTGGCCTATGACTGAACTGATGCTTTTGTCT
CTCAATAATTACTTATTTTTGTTGCTTCTCCGCAGGGTGCAAACTCTACGAAATCATGACTTATCTATTGTGGTCTTTGATGTTTATCAATGGTTAATAAGTGGGTCGAAATGTTTGTAG
TCATAGGACTTGTGGCCATTTTAGTTGGAATTCTGGATACCATTGTGCCCTGCTCATTTCTTTATCCCATTTGGGTTTTTTTTGGTTGTATAACATCATCAAGACTCGTGGGAATATGTT
TCATTAAAACAACCCCCCCACCCCCCAAATAAGAAATTAGAAAATGGTCGCTCCAAACCTGTGAAGCATACCTGTTACCTGCTTTGAAGTTCACACGGTTTGGTAGCCTTTTAATACTTG
CTGGATAGTTCTCTCCTCTGAGTTCCCTGAATTATATAAATATGAGTTAAGCAGTAGCATTATTAATTTGTCTGGAAGTGTACATGCTTTGATCTCATTCTTTTGTCACATCGTATCAAG
ACTGGTTAAAATGTTGAACAAGCTTTATCTAATAGGTCTGGCCATTTTTCAAGTTGATTCAACCGTCATTTTAGTAGTCAAGAGTTTTGTCATTTCATTTTGCAATCAGCTGTGAAAAAT
GTTTCAAGAAGTAATTACAGAAGGATTCTTTTTCTTGGACTCTTTAAGGAAAATCTCTCCGTAGAAGGTTAAGAGGTTTTCTACCTTGACTGGAGGTTTGGATCACGAGGTACGTAGAAA
ATCAAATTGTTAAGAGTTCTTAAACCTTTACTGGAGGTTATGATAATGAGAATCATAGAAGATTCGATTGTTCTATACCTTCGAATTTCTTTTTACTTACTGAAAATCATCAAGTGTACT
GGGACATTGCACATATGCTTGTTATTCTTGTCTTTCATCAGTACTGTCTCTACACTGGGCAAATTATGTGGAGGGAGGAAATAAGGATCAAACCCAAGACATAATTCTTGATATGAGTTG
GTCACTGCTGGCTGGAAAATTTGTTCTGCATCTTGTACCTGTAATTTTTAGCCAGAATTAACATTGAAATGGCAGAAAGAAAAGGTGAAAGACAAACTGCCAGAGAGGATAAGGAACAAT
TAGATTAACCAAAATATAGAAGGCTTCTGGCTAGAAAGAATTGAGGAGAAGTTGCAATACTGGTGTCCTTTCTGTAACACATCCAAAACCATCTGGCTTCACAACTAAATTTAGAGGATT
ACCCAAATGCATTACCCAAACTTGAAGTAAACATATCCAAAATTGAGTAAACACATTATTAACACATTCTTCTTTGAAAAGATCCGTTGTGTAAGCCCCACGGCTTGTACATTGATTTAC
ACAACTTATCTTCATTTGTTTCCATATCCACATTTTATTCCATCTGGTGGTATGGCCAAGTCAACTGAGGATTCAGATGACATTTTAGAAAGTCTCTAGGAGAAATACTGTGAATTTTTT
TGCTTGGACTGCAAGTTTTCAATGATTACAATTTTCCTTGTTGGTGAAGTTATTTACAAAGAAGCCTGTAACCTGATTTCCATCAGGATAGTCCATCTGTTTTCTTTGTTTATTCAGCAA
TTATTTTTTAGTTGAGAATACTACCCAAACACATCATCAGTCTTCTGTCACTACCAGTAAAACTCAGGCGATCTTTTGGAAAATTATTAGAGAAGAATAATTCGAAAACATTTCATAGGT
TTGCAATTCTCAGATTCTTTTCAGGGTATGTTCTGTAGAAGAAGATCATAACTTGATCTCTCAGATAAATTCAGCCAGTACTTGACTTCTCACATGAAGAGCGTGGTTTGTTAGTATGTT
TGGCAATGTAGTTGTAATGAGGAAAATGCTTCACACGTTTGGCTTCTCATATTATTAAAGGCTGTACAACTCCCGGTGGTCTAAGATTCACAATCTGCCTCTTAATGATTGTGGCCGCTG
GGCCTACCCTTATCTTGGGACAAGTCACATCTGATTGCATTATGAGTGTTTGTCGGGAGATTTTTCTAGTTGTTGATAGAAAACTCAAAATTACCTATTTTTAAGAACTATATCGACACA
TATTTACTACTTTATGATTTCTTGGACACTTTTCCTTGTACTCCACATTGCACAGCTCATGATAGATGTAATAGCTCTGTGGGTTTATATACCATAAATATTGGTTATCTCATACAATTT
GTTTGCTCATTTCGTATGACCAGTCGATTTATTTGAAGTTTTCAGTAGGTGCCTGTGGTTGTAGGTTTGCGTCAATGGGCAAGAAACAGCGCCCCTCTACAAATACCTCAAAGCACGTAA
AACTGGATTTTTGGGTTCAAGAATAAAATGGAACTTCACCAAGTTTTTAGTAGACAAGGAAGGGCGAGTCATCAGCCGCTACGGAACAATCACACCTCCACTAGCCATCGAG
GTAGCCGA
CAGTCTGTTCTGGCCCTCAAGTGCTCACTTCTCTGAACCACCCATTTCACTTAGCTTTGCAAGATACTTTTCCTAGTTGTTCGTTGACATTCATGGATATTTTCTATGCAGGAAGACATC
CAGAAAGCATTGGGAATGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCCGCCCAATCCGCGGACGAGAAATCCCTCCACCAGTTCGTCGTCAAGGACAGCAAGGGCAATGAGGTGAATCTCAGTGCTTACGAAGGGAAGGTTCTTCTCATCGTGAACGTT
GCTTCCAAATG
TGGGTTCACCGAACAGAACTACACGCAGCTCGCTGAACTTCACAATAGGTACAAGGATAAAGGATTCGAAATCTTGGCATTTCCATGCAACCAATTTCTCAGACAAGAG
CCAGACACTAGCCAGGAGGTGGAAGATTTTGCTTGTAACAGATACAAAGTCGAATTTCCAATTTTCCAGAAG
GTTTGCGTCAATGGGCAAGAAACAGCGCCCCTCTACAAATACCTCAAA
GCACGTAAAACTGGATTTTTGGGTTCAAGAATAAAATGGAACTTCACCAAGTTTTTAGTAGACAAGGAAGGGCGAGTCATCAGCCGCTACGGAACAATCACACCTCCACTAGCCATCGAG
GAAGACATCCAGAAAGCATTGGGAATGGCATGA

Retrieve as FASTA