Entry information : OsPrx08
Entry ID 1018
Creation 2006-06-23 (Filippo Passardi)
Last sequence changes 2006-06-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx08
Name OsPrx08
Class Class III peroxidase    [Orthogroup: Prx229]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx08
start..stop
S start..stop
OsPrx99 616 0 1..340 1..345
OsPrx[P]99-2 560 0 49..340 1..292
OsPrx[P]99-1 560 0 49..340 1..292
BdiPrx61 497 1e-178 1..340 1..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10700997..10701206 210 N° 2 10699702..10700517 816  
complement(join(10699702..10700517,10700997..10701206))


exon

Literature and cross-references OsPrx08
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9FYP5
DNA ref. GenBank:   NC_008394.1 (10701206..10699705)
Protein sequence: OsPrx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (319)
PWM (Da):   %s   36838.89 (34458.5)  
PI (pH):   %s   6.39 (6.17) Peptide Signal:   %s   cut: 23 range:23-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLTVAVICSLVAVQLWVTLLAGELKVGYYDDKCSGVEDVVKSHVIKAIILNRGNGAALVRLIFHDCFVRGCDGSVLLDASGVNPRPEKVAPVSIGLEGFDILQEIKADLERRCPGVVSCADILIFAARDASSILSNGRVRFDVPAGRLDGLVSSANEAQAELPEPTFTIRQLIDSFARKNFTVEELVVLSGAHSVGDGHCSSFTARLAAPPDQITPSYRNLLNYKCSRGGGADPAVVNNARDEDLATVARFMPAFVGKLRPVSALDNTYYRNNLDKVVNFNSDWQLLTQDEARGHVHEYADNAALWDHDFAASLLKLSKLPMPAGSKGEIRNKCSSINHR*

Retrieve as FASTA  
Remarks chromosome 1. No ESTs. TC250329
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCACGGTGGCAGTCATCTGCTCCCTGGTCGCCGTCCAGCTGTGGGTAACACTTCTCGCCGGCGAGCTGAAGGTGGGCTACTATGACGACAAATGTTCCGGCGTCGAGGACGTC
GTCAAGTCGCACGTCATCAAGGCTATCATCCTTAACAGGGGCAACGGCGCCGCCCTCGTCCGCCTCATCTTCCATGACTGCTTTGTCAGG
GTACAAATCGAATAATTTGATATTCTGTGT
TCGTGTAGAAATATTCGGCATTATGATCGATATTTAATATTTTTTGGAGGATTATTTCTTAACTATTTTAACGGCATGAGTAAAATGAACCTAAAATCCAATTCATGTATGTCTTATGGG
AGGAAGTAATTTAATTTATTTACACCTTCAGGACACACATGCCTTCTCAAAGTTCTAAACTGACCCACCTAGCTAACTTTGGTGGTTTTAAGCACGGTAAAGTGAAGTCAATTACAACGA
ACTCGATCGAATGGACATACGTGTTGTCATCTACGTCTCGCATGCTATATATTTAAACGACTATAATTTTTTTTTAAAAAAATAATAACATAATTAAGATTATAATGTCATGTGTCACTC
GACTTTCAAACTCGGTCCTTCAAGAACTTGGAAAGTTGGGAGTTGAGAAATGAGTTGTTGCATGCACAATAAATGCATGAATAATGCAGGGTTGCGATGGTTCCGTCCTCCTTGACGCGT
CCGGCGTGAACCCTCGGCCGGAGAAGGTGGCGCCGGTGAGCATCGGGCTGGAAGGATTCGACATCCTGCAGGAGATCAAGGCCGATCTCGAGAGGAGGTGCCCCGGCGTGGTCTCCTGCG
CCGACATCCTCATCTTCGCCGCCCGCGACGCCAGCAGCATCCTCAGCAACGGCCGTGTCCGCTTCGACGTCCCCGCGGGCCGCCTCGACGGCCTCGTCTCCTCCGCCAACGAGGCCCAGG
CGGAGCTCCCGGAGCCCACGTTCACCATCCGGCAGCTCATCGACAGCTTCGCCCGCAAGAACTTCACCGTCGAGGAGCTCGTCGTCCTCTCCGGCGCGCACTCCGTCGGCGACGGCCACT
GCTCCTCCTTCACCGCCCGCCTCGCCGCGCCGCCCGACCAGATCACGCCATCCTACCGCAACCTGCTCAACTACAAGTGCTCCCGCGGCGGCGGCGCCGACCCCGCGGTGGTGAACAACG
CCCGCGACGAGGACCTCGCCACCGTGGCGAGGTTCATGCCGGCGTTCGTTGGCAAGCTGCGGCCGGTCAGCGCCCTGGACAACACCTACTACCGCAACAACCTCGACAAGGTGGTCAACT
TCAACTCGGACTGGCAGCTGCTGACGCAGGACGAGGCGCGCGGCCACGTCCACGAGTACGCCGACAACGCCGCCCTCTGGGACCACGACTTCGCCGCCTCGCTGCTCAAGCTCAGCAAGC
TGCCCATGCCGGCGGGGAGCAAGGGGGAGATCAGGAACAAGTGCAGCTCCATCAACCACCGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCACGGTGGCAGTCATCTGCTCCCTGGTCGCCGTCCAGCTGTGGGTAACACTTCTCGCCGGCGAGCTGAAGGTGGGCTACTATGACGACAAATGTTCCGGCGTCGAGGACGTC
GTCAAGTCGCACGTCATCAAGGCTATCATCCTTAACAGGGGCAACGGCGCCGCCCTCGTCCGCCTCATCTTCCATGACTGCTTTGTCAGG
GGTTGCGATGGTTCCGTCCTCCTTGACGCG
TCCGGCGTGAACCCTCGGCCGGAGAAGGTGGCGCCGGTGAGCATCGGGCTGGAAGGATTCGACATCCTGCAGGAGATCAAGGCCGATCTCGAGAGGAGGTGCCCCGGCGTGGTCTCCTGC
GCCGACATCCTCATCTTCGCCGCCCGCGACGCCAGCAGCATCCTCAGCAACGGCCGTGTCCGCTTCGACGTCCCCGCGGGCCGCCTCGACGGCCTCGTCTCCTCCGCCAACGAGGCCCAG
GCGGAGCTCCCGGAGCCCACGTTCACCATCCGGCAGCTCATCGACAGCTTCGCCCGCAAGAACTTCACCGTCGAGGAGCTCGTCGTCCTCTCCGGCGCGCACTCCGTCGGCGACGGCCAC
TGCTCCTCCTTCACCGCCCGCCTCGCCGCGCCGCCCGACCAGATCACGCCATCCTACCGCAACCTGCTCAACTACAAGTGCTCCCGCGGCGGCGGCGCCGACCCCGCGGTGGTGAACAAC
GCCCGCGACGAGGACCTCGCCACCGTGGCGAGGTTCATGCCGGCGTTCGTTGGCAAGCTGCGGCCGGTCAGCGCCCTGGACAACACCTACTACCGCAACAACCTCGACAAGGTGGTCAAC
TTCAACTCGGACTGGCAGCTGCTGACGCAGGACGAGGCGCGCGGCCACGTCCACGAGTACGCCGACAACGCCGCCCTCTGGGACCACGACTTCGCCGCCTCGCTGCTCAAGCTCAGCAAG
CTGCCCATGCCGGCGGGGAGCAAGGGGGAGATCAGGAACAAGTGCAGCTCCATCAACCACCGCTAG

Retrieve as FASTA