Entry information : CgrayDyPrx02
Entry ID 10197
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: CgrayDyPrx02
Name CgrayDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Lecanoromycetes Cladoniaceae Cladonia
Organism Cladonia grayi    [TaxId: 27339 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgrayDyPrx02
start..stop
S start..stop
MpopDyPrx 223 2e-67 5..494 7..481
BcomDyPrx 221 1e-66 3..494 6..451
MpiDyPrx01 219 8e-66 5..494 6..486
TvDyPrx01 193 4e-56 4..491 8..478
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6834..7136 303 N° 2 6442..6787 346 N° 3 6072..6395 324 N° 4 5478..5995 518
complement(join(5478..5995,6072..6395,6442..6787,6834..7136))


exon

Literature and cross-references CgrayDyPrx02
DNA ref. JGI genome:   scaffold_181 (7136..5478)
Cluster/Prediction ref. JGI gene:   111163
Protein sequence: CgrayDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   498
PWM (Da):   %s   54935.38  
PI (pH):   %s   4.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVEFDLDDVQGDLFSRGFPKFNEVYYFFHIASGKEKEFCQKLKMLVSGEEKHISSINKVLDDWKQIDAARAKNHTIDDSAEKEWVTTVNTLIAFAKPGLDRIQKGLTLAGRPSLDLRYLNLSDPTFDIGMGDDGPENLNDPPVDDWDPLFTTTTIHGLLKVAGSDSKTINDKLDNLKRILGHPQQVITDIEGNSPPSLYPQSLKAIPDLENNVAVSIRCSFGYRDGLSQPLLRGINSDEALKADPYMETDLNVIITSSKPPELQDGIEADPTRRPPWMVNGSFLAFRKLEQDVPGWINLINKFQDAGCKSPAHLGAKLMGRWPSGAPVAKFPDEDAPPDTPFDNNFRYKGVSKYNCPFGAHIRKVNPRVDGGAVTTARMVRNGIPYGTDYDPANPPTDPNDRRGLLFVAYQSCLENSFQFIQRSWSNSESFPVSNTGYDAISGQAKDGGLLNITLHNADEGELVPGLGQFRETCTMKGGEYFFVPSISALKNTLGC

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAGAATTTGACCTTGACGATGTGCAGGGCGACCTCTTCAGTCGCGGGTTCCCCAAATTCAATGAGGTATACTACTTCTTCCATATCGCGTCAGGTAAGGAGAAGGAGTTCTGCCAA
AAGCTGAAAATGTTGGTCTCGGGAGAAGAGAAGCACATTTCAAGCATAAACAAGGTCCTCGACGACTGGAAACAAATAGATGCCGCCCGTGCGAAGAATCATACTATAGACGATTCCGCG
GAAAAGGAATGGGTCACTACAGTAAATACCTTGATTGCTTTCGCGAAACCTGGCCTAGACAGA
GTAAGCGATCAAATATTACGCTGATTACCACCGCTGATTCAAGCAGATTCAGAAGGG
TTTGACATTGGCTGGTCGTCCAAGTTTAGACCTAAGATATCTGAACTTGTCAGATCCCACCTTCGATATAGGTATGGGTGACGACGGTCCGGAGAACCTGAATGACCCTCCTGTAGACGA
CTGGGATCCTCTTTTTACGACCACTACAATCCATGGTCTACTCAAAGTCGCCGGAAGCGACTCCAAGACCATTAATGACAAGTTGGACAACCTTAAGCGTATTCTCGGCCATCCCCAACA
AGTCATCACAGACATCGAGGGGAATTCCCCCCCCTCACTTTACCCTCAAAGCTTGAAGGCAATACCAGACCTGGAGAACAACGTGGCCGTGAGCA
GTAAGTTAGAGTCCCTACCGTTTAA
TACCCTTTATTGTTGATTAAGTCCGATGCAGCTTTGGCTATCGAGACGGACTCTCGCAACCACTTCTGAGAGGCATCAACTCAGATGAAGCTCTCAAAGCGGATCCATATATGGAGACAG
ACCTGAACGTCATCATCACATCCTCAAAGCCGCCTGAATTACAGGACGGTATCGAGGCCGATCCAACGAGGCGCCCACCCTGGATGGTCAATGGCAGCTTCCTCGCTTTCCGCAAGCTCG
AACAAGACGTCCCAGGATGGATAAACCTCATCAACAAATTCCAAGATGCAGGTTGCAAAAGCCCCGCTCACTTGGGCGCAAAACTCATGGGCCGCTGGCCAAGCG
GTAAGGATCCAAGAC
CTCCCAAACATCGCCGCTCCTTTCTTAGTGATGATCAGCTGACACGCCATTTCTATACTAGGAGCCCCCGTCGCCAAATTCCCCGACGAAGATGCCCCTCCTGACACTCCCTTCGACAAC
AATTTCCGCTACAAAGGCGTCTCCAAATACAACTGCCCTTTCGGCGCACACATCCGCAAAGTCAACCCACGCGTAGACGGCGGAGCCGTTACCACAGCCCGCATGGTCCGCAACGGCATC
CCCTACGGCACCGACTACGATCCCGCCAATCCGCCAACAGACCCCAACGACAGGCGCGGCCTCCTCTTCGTGGCATACCAGTCCTGCCTTGAGAATAGCTTCCAGTTCATACAGCGGAGT
TGGTCCAATAGTGAGAGTTTTCCGGTTTCGAACACGGGATATGATGCGATTAGTGGCCAGGCGAAAGATGGGGGGTTGTTGAATATCACGTTGCATAATGCGGATGAGGGGGAGCTCGTT
CCGGGGTTGGGACAGTTCCGCGAGACGTGTACGATGAAAGGAGGGGAGTATTTCTTTGTGCCATCGATTTCGGCATTGAAGAATACGTTGGGCTGTGAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAGAATTTGACCTTGACGATGTGCAGGGCGACCTCTTCAGTCGCGGGTTCCCCAAATTCAATGAGGTATACTACTTCTTCCATATCGCGTCAGGTAAGGAGAAGGAGTTCTGCCAA
AAGCTGAAAATGTTGGTCTCGGGAGAAGAGAAGCACATTTCAAGCATAAACAAGGTCCTCGACGACTGGAAACAAATAGATGCCGCCCGTGCGAAGAATCATACTATAGACGATTCCGCG
GAAAAGGAATGGGTCACTACAGTAAATACCTTGATTGCTTTCGCGAAACCTGGCCTAGACAGA
ATTCAGAAGGGTTTGACATTGGCTGGTCGTCCAAGTTTAGACCTAAGATATCTGAAC
TTGTCAGATCCCACCTTCGATATAGGTATGGGTGACGACGGTCCGGAGAACCTGAATGACCCTCCTGTAGACGACTGGGATCCTCTTTTTACGACCACTACAATCCATGGTCTACTCAAA
GTCGCCGGAAGCGACTCCAAGACCATTAATGACAAGTTGGACAACCTTAAGCGTATTCTCGGCCATCCCCAACAAGTCATCACAGACATCGAGGGGAATTCCCCCCCCTCACTTTACCCT
CAAAGCTTGAAGGCAATACCAGACCTGGAGAACAACGTGGCCGTGAGCA
TCCGATGCAGCTTTGGCTATCGAGACGGACTCTCGCAACCACTTCTGAGAGGCATCAACTCAGATGAAGCT
CTCAAAGCGGATCCATATATGGAGACAGACCTGAACGTCATCATCACATCCTCAAAGCCGCCTGAATTACAGGACGGTATCGAGGCCGATCCAACGAGGCGCCCACCCTGGATGGTCAAT
GGCAGCTTCCTCGCTTTCCGCAAGCTCGAACAAGACGTCCCAGGATGGATAAACCTCATCAACAAATTCCAAGATGCAGGTTGCAAAAGCCCCGCTCACTTGGGCGCAAAACTCATGGGC
CGCTGGCCAAGCG
GAGCCCCCGTCGCCAAATTCCCCGACGAAGATGCCCCTCCTGACACTCCCTTCGACAACAATTTCCGCTACAAAGGCGTCTCCAAATACAACTGCCCTTTCGGCGCA
CACATCCGCAAAGTCAACCCACGCGTAGACGGCGGAGCCGTTACCACAGCCCGCATGGTCCGCAACGGCATCCCCTACGGCACCGACTACGATCCCGCCAATCCGCCAACAGACCCCAAC
GACAGGCGCGGCCTCCTCTTCGTGGCATACCAGTCCTGCCTTGAGAATAGCTTCCAGTTCATACAGCGGAGTTGGTCCAATAGTGAGAGTTTTCCGGTTTCGAACACGGGATATGATGCG
ATTAGTGGCCAGGCGAAAGATGGGGGGTTGTTGAATATCACGTTGCATAATGCGGATGAGGGGGAGCTCGTTCCGGGGTTGGGACAGTTCCGCGAGACGTGTACGATGAAAGGAGGGGAG
TATTTCTTTGTGCCATCGATTTCGGCATTGAAGAATACGTTGGGCTGTGAT

Retrieve as FASTA