Entry information : NdisDyPrx
Entry ID 10199
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-26 (Catherine Mathe (Scipio))
Peroxidase information: NdisDyPrx
Name NdisDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora discreta    [TaxId: 29879 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NdisDyPrx
start..stop
S start..stop
NtetDyPrx01_2509 885 0 1..518 1..513
NtetDyPrx01_2508 882 0 1..518 1..513
NcDyPrx 879 0 1..518 1..513
SmaDyPrx 871 0 1..518 1..513
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 292972..293015 44 N° 2 293104..293344 241 N° 3 293406..293791 386 N° 4 293861..293953 93
N° 5 294029..294139 111 N° 6 294204..294304 101 N° 7 294372..294952 581  
join(292972..293015,293104..293344,293406..293791,293861..293953,294029..294139, 294204..294304,294372..294952)


exon

Literature and cross-references NdisDyPrx
DNA ref. JGI genome:   scaffold_15 (292972..294952)
Cluster/Prediction ref. JGI gene:   169369
Protein sequence: NdisDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   519
PWM (Da):   %s   58718.62  
PI (pH):   %s   7.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNWVARKANIQGDIWPGLPKRFQTFLFFKIRKPDEFKTRLKSFVEDGYITTAKDACNMYSQIDEAKKQASKQGSQTNLLPLPGVNISFASTGLALGKFTFKDGLVKKDRELSKIFKKNQLRGGLFAKGMYDDMVGEGWDEPVELRQEFKPTSEGKRLIDGVMMVTASRADDLRYHTLRVQEYFLKDLEADTGDPDTVRLSNDPIIDFPLITHGRARPEKGKEHFGFEDGISQPKIEGLDEEPPKGKEPKAVKSGMIFARHDGDDMNQPEWAEDGSFLVIRELQQLVPEFEKWLEDNKHHAPFPTNSDADPKEKLAAYLMGRWRGTPVDESPHDHKDPNLFKSNNFDYHPTHKHDKCPFAAHIRKMRPRGDLEHDHAVIIRRGISYGSEVTPEEMAAQKSDEKKERGLMFVCYQSDIRNGFNFLTTRWASNHHFPDRKANFVGEHGPGIDAIVGQRLDHHPPRSIGLPDGKHPTEARIGLERWVIPKGGEYFFTPSISALKGYLTAPPDYPPALAGP

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGGGTCGCGAGGAAAGCCAACATTCAGGGTGACATCTGGTTAGTCTCATGTCGCTAGACTGCACATCCATGTTCTTTTGAGATGTCGTCCATGGTTTGCTGATCCCTCAATCTT
CCCATTCATTAGGCCCGGCCTGCCAAAAAGGTTCCAGACCTTCCTCTTCTTCAAGATCAGGAAGCCAGATGAATTCAAGACGCGACTCAAATCCTTTGTGGAGGACGGCTATATCACCAC
CGCCAAGGATGCCTGTAACATGTACAGCCAGATCGACGAGGCAAAGAAACAAGCAAGCAAGCAGGGTTCCCAGACCAACCTTCTGCCCTTGCCAGGCGTCAACATTTCCTTTGCCTCGAC
TGGTCTAGCAGCT
GTAAGTCATGGCCAAGGCGTCGCCGTGCTAGAGAGACTGGCTGACTGATCCAACACATTAGCTGGGAAAATTCACCTTTAAAGATGGCCTCGTCAAAAAGGACAGAG
AGCTATCCAAGATCTTCAAGAAGAACCAGCTCCGTGGTGGCTTGTTCGCGAAGGGCATGTACGATGACATGGTGGGCGAGGGCTGGGACGAGCCGGTCGAGCTTCGACAAGAGTTCAAGC
CTACGTCTGAGGGAAAGCGGCTGATTGATGGCGTGATGATGGTAACTGCGAGTCGTGCGGATGACCTGAGATACCACACCCTTCGCGTCCAGGAATACTTCCTTAAGGACCTGGAGGCGG
ACACTGGTGATCCGGATACTGTCCGGCTCAGCAATGACCCCATCATCGACTTCCCGTTGATCACCCATGGTCGAGCTCGCCCTGAAAAGGGCAAGGAACA
GTGAGTCCTGTCATGTCTGC
TTGATGGTGATCAGCACGGACTGGACTGACAGACTGTGTGATTTTCCAGTTTCGGCTTCGAGGACGGCATTAGCCAGCCCAAGATTGAGGGATTGGATGAAGAGCCGCCCAAGGGCAAAG
AGCCAAAGGCTGTCAAGTCAGG
GTGAGTTGTTCCGGAGCGATAGTCACCTTGATCGGTATTGATGATTGGAACTGACAAGGGGGATTCGGATTGCAGAATGATCTTTGCCAGACACGACG
GCGACGACATGAACCAGCCGGAATGGGCCGAGGACGGCAGTTTCCTCGTCATTCGTGAGCTTCAACAACTCGTCCCCGAGTTTGAGAA
GTAAGTTTCCATTCTACGCATCAGAAACAAGT
AGGGTCAGTACACTGACTCCACACAACTTCAGGTGGCTCGAAGACAACAAACACCATGCGCCGTTCCCCACAAACTCCGATGCCGACCCGAAGGAAAAGCTTGCAGCGTATCTGATGGGC
AGATGGAGAAACG
GTACGTGCCGATCAGTCTATTCAGTCAATTCCAAGCTCGTTTTGCTCATGAACATTGTTCACAACAGGAACCCCCGTCGACGAGAGCCCTCACGACCACAAGGACCC
AAACCTTTTCAAGTCCAACAACTTTGACTACCACCCCACCCACAAGCACGACAAGTGCCCCTTTGCCGCTCACATCCGTAAGATGCGGCCCCGCGGCGACCTGGAACATGATCACGCCGT
CATTATTCGTCGTGGCATCTCCTACGGCAGCGAAGTGACGCCGGAGGAAATGGCCGCTCAAAAGTCGGATGAGAAGAAGGAGCGTGGCCTGATGTTTGTGTGCTACCAAAGCGACATCCG
CAACGGCTTCAACTTCTTGACCACCCGCTGGGCGAGCAACCACCACTTCCCGGACCGCAAGGCCAACTTTGTGGGCGAGCACGGCCCTGGTATCGATGCCATTGTGGGCCAGAGACTGGA
TCACCACCCACCTCGGTCGATCGGTCTGCCGGATGGCAAGCATCCGACTGAGGCGCGTATTGGACTCGAGCGCTGGGTGATCCCCAAGGGTGGTGAATACTTCTTTACGCCGTCCATTAG
CGCGCTCAAGGGATATCTGACTGCTCCCCCCGATTACCCGCCTGCGCTTGCTGGGCCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGGGTCGCGAGGAAAGCCAACATTCAGGGTGACATCTGGCCCGGCCTGCCAAAAAGGTTCCAGACCTTCCTCTTCTTCAAGATCAGGAAGCCAGATGAATTCAAGACGCGACTC
AAATCCTTTGTGGAGGACGGCTATATCACCACCGCCAAGGATGCCTGTAACATGTACAGCCAGATCGACGAGGCAAAGAAACAAGCAAGCAAGCAGGGTTCCCAGACCAACCTTCTGCCC
TTGCCAGGCGTCAACATTTCCTTTGCCTCGACTGGTCTAGCAGCT
CTGGGAAAATTCACCTTTAAAGATGGCCTCGTCAAAAAGGACAGAGAGCTATCCAAGATCTTCAAGAAGAACCAG
CTCCGTGGTGGCTTGTTCGCGAAGGGCATGTACGATGACATGGTGGGCGAGGGCTGGGACGAGCCGGTCGAGCTTCGACAAGAGTTCAAGCCTACGTCTGAGGGAAAGCGGCTGATTGAT
GGCGTGATGATGGTAACTGCGAGTCGTGCGGATGACCTGAGATACCACACCCTTCGCGTCCAGGAATACTTCCTTAAGGACCTGGAGGCGGACACTGGTGATCCGGATACTGTCCGGCTC
AGCAATGACCCCATCATCGACTTCCCGTTGATCACCCATGGTCGAGCTCGCCCTGAAAAGGGCAAGGAACA
TTTCGGCTTCGAGGACGGCATTAGCCAGCCCAAGATTGAGGGATTGGAT
GAAGAGCCGCCCAAGGGCAAAGAGCCAAAGGCTGTCAAGTCAGG
AATGATCTTTGCCAGACACGACGGCGACGACATGAACCAGCCGGAATGGGCCGAGGACGGCAGTTTCCTCGTCATT
CGTGAGCTTCAACAACTCGTCCCCGAGTTTGAGAA
GTGGCTCGAAGACAACAAACACCATGCGCCGTTCCCCACAAACTCCGATGCCGACCCGAAGGAAAAGCTTGCAGCGTATCTGATG
GGCAGATGGAGAAACG
GAACCCCCGTCGACGAGAGCCCTCACGACCACAAGGACCCAAACCTTTTCAAGTCCAACAACTTTGACTACCACCCCACCCACAAGCACGACAAGTGCCCCTTT
GCCGCTCACATCCGTAAGATGCGGCCCCGCGGCGACCTGGAACATGATCACGCCGTCATTATTCGTCGTGGCATCTCCTACGGCAGCGAAGTGACGCCGGAGGAAATGGCCGCTCAAAAG
TCGGATGAGAAGAAGGAGCGTGGCCTGATGTTTGTGTGCTACCAAAGCGACATCCGCAACGGCTTCAACTTCTTGACCACCCGCTGGGCGAGCAACCACCACTTCCCGGACCGCAAGGCC
AACTTTGTGGGCGAGCACGGCCCTGGTATCGATGCCATTGTGGGCCAGAGACTGGATCACCACCCACCTCGGTCGATCGGTCTGCCGGATGGCAAGCATCCGACTGAGGCGCGTATTGGA
CTCGAGCGCTGGGTGATCCCCAAGGGTGGTGAATACTTCTTTACGCCGTCCATTAGCGCGCTCAAGGGATATCTGACTGCTCCCCCCGATTACCCGCCTGCGCTTGCTGGGCCTTGA

Retrieve as FASTA