Entry information : GluxDyPrx03
Entry ID 10201
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxDyPrx03
Name GluxDyPrx03
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxDyPrx03
start..stop
S start..stop
GluxDyPrx07 838 0 1..516 1..500
GluxDyPrx08 819 0 1..516 1..509
GluxDyPrx04 746 0 1..516 1..532
GluxDyPrx06 733 0 1..515 1..515
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 772751..772865 115 N° 2 772915..773011 97 N° 3 773072..773517 446 N° 4 773577..773866 290
N° 5 773941..774163 223 N° 6 774217..774285 69 N° 7 774339..774405 67 N° 8 774474..774540 67
N° 9 774680..774779 100 N° 10 774834..774910 77  
join(772751..772865,772915..773011,773072..773517,773577..773866,773941..774163, 774217..774285,774339..774405,774474..774540,774680..774779,774834..774910)


exon

Literature and cross-references GluxDyPrx03
DNA ref. JGI genome:   scaffold_16 (772751..774910)
Cluster/Prediction ref. JGI gene:   241961
Protein sequence: GluxDyPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   517 (497)
PWM (Da):   %s   54675.84 (52494.6)  
PI (pH):   %s   5.91 (5.62) Peptide Signal:   %s   cut: 20 range:20-516
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTLFSLLVVFALQGVYSVPNLSSNDLKPRRTSSILINPAALPDLPSAQQAASASASVGLNLTNIQGDILIGMKKNKELFVFFSIVNPKSFKSQLKANILPLITSTTQVLAVSTQPNTLVNIAFSQRGLTALGITDNLGDSLFANGQFSDAGNLGDTTSNWVSAFAGTNIHGVLLLASDTIANINSTLSQLQNTLNGSISEVYSIQGQARPGNEQGHEHFGFMDGISNPAVSGFSTPLPGQAVVAPGIILAGEQGDGTSRPSWATDGSFLAFRQLKQRVPEFNKFLLDNALSEPNLTVAQNAELLGARMMGRWKSGAPIDLTPLADDPVLAADPQRNNNFNFTHPGFNLNTDQSHCPFSAHIRKTNPRADLGGSFPNHIIRAGIPYGPEVTTAEAASNTSSTDPSQERGLAFVAYQSSISTGFAFLQKTWANSASISLLFNDFILTTAPPFFRNYSGGQDPIIGVAGNDGPRSVGGLDPLNSSKDITLTQDFVVSRGGEYFFSPSLSAIQNTLSA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACGCTCTTTTCGTTATTGGTGGTCTTTGCGCTGCAAGGCGTGTATTCTGTACCAAATCTTTCATCCAATGACCTGAAACCTAGACGAACGAGCTCGATTCTCATTAGTAAG
TATTCAAGGAGAATCGCAAAACTTGAAACTTATAAGACATACAGATCCTGCTGCTCTGCCTGACCTGCCGTCTGCTCAGCAGGCAGCGAGTGCTTCCGCCTCGGTGGGCTTAAACCTCAC
CAACATCCAGGGAGATATTCT
GTAAGTGCTCTCTTTCATCCTATTCGGTATTTCATATCTGATTCAGACCCGATACCAAAGTATCGGGATGAAGAAAAACAAAGAGTTGTTCGTCTTTTT
TAGCATTGTGAACCCGAAATCCTTCAAGTCCCAACTCAAAGCGAATATTCTCCCTTTGATTACTTCGACGACCCAAGTGCTCGCGGTTAGCACGCAACCTAATACCCTTGTGAATATTGC
CTTCTCTCAGAGAGGCCTTACAGCATTGGGAATAACGGACAACTTGGGCGACAGTCTCTTTGCGAACGGACAATTTTCTGATGCAGGGAATCTCGGTGACACGACTAGTAACTGGGTTTC
GGCATTTGCTGGTACTAATATCCATGGTGTCCTCCTCCTCGCCTCGGACACGATAGCCAATATAAACAGCACGCTGTCCCAGCTCCAAAATACATTGAACGGTTCAATTTCTGAAGTTTA
CAGTATTCAGGGTCAGGCGAGACCCGGAAACGAGCAAGGTCACGAAC
GTAAGATTGGTTTCCTTCGTTTCAGTATGATTCACTGTGACTGAAGTGCTGTTATTCAGACTTTGGATTCATG
GATGGAATCAGTAATCCAGCAGTCTCCGGGTTCTCTACACCTCTCCCAGGTCAAGCAGTTGTTGCACCGGGTATTATTCTAGCTGGAGAACAGGGCGACGGGACGAGCCGTCCTTCTTGG
GCTACAGACGGCTCGTTCCTGGCCTTCCGTCAACTTAAACAACGTGTTCCCGAGTTCAATAAGTTTTTGCTTGACAACGCTCTTTCGGAACCCAATCTGACGGTCGCTCAAAATGCTGAG
CTGCTCGGAGCTCGCATGATGGGACGATGGAAGAGT
GTAAGTACATATATCAACCGCTTGTCCCTGCTTTTGCATACCGGGTCTCTACTAAACTCATATTTCCTTGGTAGGGAGCCCCTA
TTGATCTTACACCCCTTGCGGACGATCCTGTTCTTGCGGCGGATCCTCAACGGAACAACAACTTCAACTTCACTCATCCGGGTTTCAACCTCAACACCGACCAATCTCATTGTCCATTCT
CCGCCCACATCCGAAAGACCAACCCTCGTGCAGACTTGGGTGGAAGCTTCCCCAATCATATCATTCGTGCCGGAATCCCGTACGGACCTGAAG
GTAAATTCTGCACACCTTATCGAATGA
TTATTGCTCATGGTTATCCTGTTCAGTTACCACCGCTGAAGCTGCTTCCAACACTTCGAGCACAGATCCTTCTCAGGAACGAGGTTTAGCTTTTGGTACGATGATTTATTGTGTGCGCGA
GGACCGAACCTAAAGTTTTGTCGTCCAGTCGCATACCAATCGTCGATTAGCACAGGGTTTGCATTCCTCCAGAAAACTTGGGCTAATAGCGCTAGGTGAGTAGTGAATTTTTCGAGCTCA
TGATAGTTACTGATTCTTCTGTCACAGTTTCGTCCACTGTAAGTATTTCATTACTCTTTAACGACTTCATCTTGACCACTGCTCCTCCTTTCTTTCGCAACTACAGCGGGGTATGTATTC
AATCCTTTTCTCAGCTTTATAACGTTCCTGTTAACCGCTTTCGTTTCTCTTTTTTCTCTCGATAAATAGTGTTGTAAGTGCCGGATTTATCCGGTGAAAGATTGTTCATTTTCTAAGTTC
CTTCCGTAGGGTCAAGATCCCATTATCGGCGTAGCGGGGAATGACGGACCTAGAAGTGTTGGTGGCCTCGACCCGTTGAACTCATCCAAGGATATAACCTTAACCCAAGGTACATTCCCG
AGCCTTTGTAGGTTATAGTAATGGAATGCTTATTCTCCTTCAGATTTCGTTGTTTCCCGAGGAGGAGAATACTTCTTCTCGCCCTCTCTTTCGGCCATTCAAAACACGCTCTCTGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACGCTCTTTTCGTTATTGGTGGTCTTTGCGCTGCAAGGCGTGTATTCTGTACCAAATCTTTCATCCAATGACCTGAAACCTAGACGAACGAGCTCGATTCTCATTAATCCT
GCTGCTCTGCCTGACCTGCCGTCTGCTCAGCAGGCAGCGAGTGCTTCCGCCTCGGTGGGCTTAAACCTCACCAACATCCAGGGAGATATTCT
TATCGGGATGAAGAAAAACAAAGAGTTG
TTCGTCTTTTTTAGCATTGTGAACCCGAAATCCTTCAAGTCCCAACTCAAAGCGAATATTCTCCCTTTGATTACTTCGACGACCCAAGTGCTCGCGGTTAGCACGCAACCTAATACCCTT
GTGAATATTGCCTTCTCTCAGAGAGGCCTTACAGCATTGGGAATAACGGACAACTTGGGCGACAGTCTCTTTGCGAACGGACAATTTTCTGATGCAGGGAATCTCGGTGACACGACTAGT
AACTGGGTTTCGGCATTTGCTGGTACTAATATCCATGGTGTCCTCCTCCTCGCCTCGGACACGATAGCCAATATAAACAGCACGCTGTCCCAGCTCCAAAATACATTGAACGGTTCAATT
TCTGAAGTTTACAGTATTCAGGGTCAGGCGAGACCCGGAAACGAGCAAGGTCACGAAC
ACTTTGGATTCATGGATGGAATCAGTAATCCAGCAGTCTCCGGGTTCTCTACACCTCTCCCA
GGTCAAGCAGTTGTTGCACCGGGTATTATTCTAGCTGGAGAACAGGGCGACGGGACGAGCCGTCCTTCTTGGGCTACAGACGGCTCGTTCCTGGCCTTCCGTCAACTTAAACAACGTGTT
CCCGAGTTCAATAAGTTTTTGCTTGACAACGCTCTTTCGGAACCCAATCTGACGGTCGCTCAAAATGCTGAGCTGCTCGGAGCTCGCATGATGGGACGATGGAAGAGT
GGAGCCCCTATT
GATCTTACACCCCTTGCGGACGATCCTGTTCTTGCGGCGGATCCTCAACGGAACAACAACTTCAACTTCACTCATCCGGGTTTCAACCTCAACACCGACCAATCTCATTGTCCATTCTCC
GCCCACATCCGAAAGACCAACCCTCGTGCAGACTTGGGTGGAAGCTTCCCCAATCATATCATTCGTGCCGGAATCCCGTACGGACCTGAAG
TTACCACCGCTGAAGCTGCTTCCAACACT
TCGAGCACAGATCCTTCTCAGGAACGAGGTTTAGCTTTTG
TCGCATACCAATCGTCGATTAGCACAGGGTTTGCATTCCTCCAGAAAACTTGGGCTAATAGCGCTAGTATTTCATTACTC
TTTAACGACTTCATCTTGACCACTGCTCCTCCTTTCTTTCGCAACTACAGCGGG
GGTCAAGATCCCATTATCGGCGTAGCGGGGAATGACGGACCTAGAAGTGTTGGTGGCCTCGACCCG
TTGAACTCATCCAAGGATATAACCTTAACCCAAG
ATTTCGTTGTTTCCCGAGGAGGAGAATACTTCTTCTCGCCCTCTCTTTCGGCCATTCAAAACACGCTCTCTGCTTAG

Retrieve as FASTA