Entry information : GluxDyPrx04
Entry ID 10202
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxDyPrx04
Name GluxDyPrx04
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxDyPrx04
start..stop
S start..stop
GluxDyPrx06 819 0 1..532 1..516
GluxDyPrx03 761 0 1..531 1..515
GluxDyPrx07 741 0 1..531 1..499
GluxDyPrx08 740 0 1..531 1..508
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 776443..776620 178 N° 2 776668..776764 97 N° 3 776823..777268 446 N° 4 777327..777616 290
N° 5 777680..777905 226 N° 6 777965..778033 69 N° 7 778091..778157 67 N° 8 778215..778225 11
N° 9 778334..778371 38 N° 10 778430..778529 100 N° 11 778581..778657 77  
join(776443..776620,776668..776764,776823..777268,777327..777616,777680..777905, 777965..778033,778091..778157,778215..778225,778334..778371,778430..778529,77858 1..778657)


exon

Literature and cross-references GluxDyPrx04
DNA ref. JGI genome:   scaffold_16 (776443..778657)
Cluster/Prediction ref. JGI gene:   241962
Protein sequence: GluxDyPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   533 (513)
PWM (Da):   %s   56478.55 (54420.4)  
PI (pH):   %s   6.96 (6.72) Peptide Signal:   %s   cut: 20 range:20-532
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTLVSLFAVSALQGVNSLPLFGFNFSFFPFFSPPSSSRPSPSKCFSCRGQRTSSIFINPSAQPGLPSAQQASSAAASAGLNLTNIQGDVLIGMKKNKELFFFFNIVDPKTFKSQLGASILPLITSTDQLLSVSTQPITTLNIAFSQKGLTALGKTDNLGDSLFSNGQLSDAPNLGDQTGNWVSAFAGTNIHGVLLLASDTVDNVNSLLAQIQTTLASSISEVYRIQGQARPGDQAGHEHFGYMDGISNPAISGFSTPLPGQAVIQPGIILVGEQGDTTKRPSWAKDGSFLAFRQLQQRVPEFNKFLNDNALSEPNLTAAQNAELLGARMMGRWKSGAPIDLAPLADDPTLAADPQRNNNFNFTHPGFDLTTDQSHCPFSAHIRKTNPRADLSGGNFRNHIIRAGIPYGPEVTDVETISSTSSTDPSLERGLAFVAYQSSIATGFKFLQQTWANNPSFHTSFLTNLPPSANSVGQDPIIGVASGGGARSSGGLDPLNTAKATSINQNFVISRGGEYFFTPSLSAIQNTLSV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACACTCGTTTCGTTATTCGCCGTTTCTGCCCTGCAGGGCGTGAATTCTCTCCCACTCTTCGGCTTTAATTTTTCGTTCTTTCCTTTCTTCTCCCCACCTTCTTCCTCCCGC
CCTTCTCCCTCCAAATGCTTCTCATGCAGAGGACAACGAACGAGCTCCATTTTCATCA
GTAAGCATTCAAGACAATCAAAGACCCAAATATTTATCTCCATACAGATCCTTCCGCTCAGC
CTGGCCTGCCTTCCGCTCAGCAGGCATCGAGTGCCGCCGCTTCCGCGGGTTTGAACCTTACCAACATTCAGGGGGATGTTCT
GTAAGTCGGATTTCTCTAGCTCTTCTTATCAGTCTGTC
TTGCTAACTCGGGTCAAAAGTATCGGAATGAAGAAAAACAAAGAGCTGTTCTTTTTCTTCAACATTGTAGACCCCAAAACTTTCAAGTCTCAACTTGGAGCGAGTATTCTTCCTCTAATC
ACGTCAACTGACCAACTGCTCTCGGTCAGCACGCAGCCCATCACCACTCTGAACATCGCCTTCTCTCAAAAAGGCCTGACAGCCTTAGGAAAGACAGACAACCTCGGTGACTCTCTCTTC
TCAAACGGACAGCTGTCGGACGCTCCGAATCTTGGTGATCAAACCGGCAACTGGGTTTCTGCTTTCGCGGGTACCAACATACACGGCGTCCTCTTACTTGCCTCAGATACGGTAGACAAT
GTGAACAGCCTGCTCGCTCAAATCCAAACTACTTTGGCCAGTTCAATTTCCGAAGTTTACCGTATTCAAGGTCAAGCGAGGCCGGGGGATCAGGCTGGTCATGAAC
GTAAGATTAATTCC
TCCCCTTTGTTTCGAATGCTTCTGACTGAGAGTTGGTTGCTTAGACTTTGGGTACATGGATGGGATCAGCAACCCAGCGATCTCTGGATTCTCTACACCCCTTCCAGGTCAAGCAGTTAT
CCAACCAGGGATTATTCTGGTTGGAGAACAAGGCGACACGACGAAGCGTCCTTCTTGGGCGAAAGACGGCTCGTTCCTTGCCTTCCGTCAGCTCCAGCAGCGTGTGCCCGAGTTTAACAA
GTTCTTGAACGACAATGCTCTCTCCGAACCTAACCTGACTGCCGCGCAGAATGCAGAGCTTCTCGGAGCTCGAATGATGGGACGATGGAAGAGT
GTGAGTAGTCGTTTGTGCTGTTTCCA
AGCCTTTGCTTACCGACTGTTGTTTCTCGCAATTTAGGGAGCTCCGATTGATCTTGCACCTCTCGCGGACGATCCCACGCTTGCGGCGGATCCTCAACGGAACAATAACTTCAACTTCAC
TCATCCGGGTTTCGACCTAACCACCGACCAATCTCACTGTCCGTTCTCCGCCCACATCCGGAAGACCAACCCTCGCGCGGACTTGTCAGGAGGAAACTTCCGCAATCATATCATACGCGC
TGGAATCCCGTACGGACCTGAAG
GTACGTCCACTCAGACTTGTCAGTTAATAGTTTACACAATGTCCGACCGGGTTTGCTAGTTACGGACGTTGAGACTATCTCCAGTACCTCGAGCACC
GATCCCAGTCTCGAGAGGGGATTAGCTTTTG
GTATGTTATCCATGGTATCTGGCGTGTCAAATTACAACCTCAAAACTCGGCGTACAGTCGCATATCAGTCGTCCATCGCCACCGGCTTC
AAATTCCTCCAGCAGACCTGGGCAAATAACCCATC
GTGAGTGGTATGCGACTGTCCCCGTAGCAGTACGCTGACTTGCTTTGTCCGTTGCAGCTTCCACACATGTAAGTAGTTTCAATCA
CTGCTCTTCTGTCGAATGTCATTTTGACCATTGGTTCTGCCTTTCGTGCCTGCAGCGAAGTGAGTCCGCTCGTGTTTTTCCAGCTTGCCAGCGTTTCTGACAAATCTTCCTCCCTCCGCT
AACAGCGTT
GTAAGTTCCGGATTCACCAAGCTAAGAAAATCGCGAGTATTCTGACTTCCTTTCGCAGGGTCAAGATCCCATTATCGGAGTCGCTTCCGGAGGAGGGGCTAGAAGTTCTGG
TGGACTCGATCCCCTCAACACGGCGAAGGCCACCAGCATCAACCAAA
GTACGTGTTTAGCCCCCTCCTCCTGATATCGGAAGGCTCATGCACTTCTAGATTTCGTAATCTCCCGAGGAGG
GGAATACTTCTTCACGCCTTCGCTTTCGGCGATTCAGAACACGCTCTCTGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACACTCGTTTCGTTATTCGCCGTTTCTGCCCTGCAGGGCGTGAATTCTCTCCCACTCTTCGGCTTTAATTTTTCGTTCTTTCCTTTCTTCTCCCCACCTTCTTCCTCCCGC
CCTTCTCCCTCCAAATGCTTCTCATGCAGAGGACAACGAACGAGCTCCATTTTCATCA
ATCCTTCCGCTCAGCCTGGCCTGCCTTCCGCTCAGCAGGCATCGAGTGCCGCCGCTTCCGCG
GGTTTGAACCTTACCAACATTCAGGGGGATGTTCT
TATCGGAATGAAGAAAAACAAAGAGCTGTTCTTTTTCTTCAACATTGTAGACCCCAAAACTTTCAAGTCTCAACTTGGAGCGAGT
ATTCTTCCTCTAATCACGTCAACTGACCAACTGCTCTCGGTCAGCACGCAGCCCATCACCACTCTGAACATCGCCTTCTCTCAAAAAGGCCTGACAGCCTTAGGAAAGACAGACAACCTC
GGTGACTCTCTCTTCTCAAACGGACAGCTGTCGGACGCTCCGAATCTTGGTGATCAAACCGGCAACTGGGTTTCTGCTTTCGCGGGTACCAACATACACGGCGTCCTCTTACTTGCCTCA
GATACGGTAGACAATGTGAACAGCCTGCTCGCTCAAATCCAAACTACTTTGGCCAGTTCAATTTCCGAAGTTTACCGTATTCAAGGTCAAGCGAGGCCGGGGGATCAGGCTGGTCATGAA
C
ACTTTGGGTACATGGATGGGATCAGCAACCCAGCGATCTCTGGATTCTCTACACCCCTTCCAGGTCAAGCAGTTATCCAACCAGGGATTATTCTGGTTGGAGAACAAGGCGACACGACG
AAGCGTCCTTCTTGGGCGAAAGACGGCTCGTTCCTTGCCTTCCGTCAGCTCCAGCAGCGTGTGCCCGAGTTTAACAAGTTCTTGAACGACAATGCTCTCTCCGAACCTAACCTGACTGCC
GCGCAGAATGCAGAGCTTCTCGGAGCTCGAATGATGGGACGATGGAAGAGT
GGAGCTCCGATTGATCTTGCACCTCTCGCGGACGATCCCACGCTTGCGGCGGATCCTCAACGGAACAAT
AACTTCAACTTCACTCATCCGGGTTTCGACCTAACCACCGACCAATCTCACTGTCCGTTCTCCGCCCACATCCGGAAGACCAACCCTCGCGCGGACTTGTCAGGAGGAAACTTCCGCAAT
CATATCATACGCGCTGGAATCCCGTACGGACCTGAAG
TTACGGACGTTGAGACTATCTCCAGTACCTCGAGCACCGATCCCAGTCTCGAGAGGGGATTAGCTTTTGTCGCATATCAGTCG
TCCATCGCCACCGGCTTCAAATTCCTCCAGCAGACCTGGGCAAATAACCCATC
CTTCCACACATCGTTTCTGACAAATCTTCCTCCCTCCGCTAACAGCGTTGGTCAAGATCCCATTATC
GGAGTCGCTTCCGGAGGAGGGGCTAGAAGTTCTGGTGGACTCGATCCCCTCAACACGGCGAAGGCCACCAGCATCAACCAAA
ATTTCGTAATCTCCCGAGGAGGGGAATACTTCTTCACG
CCTTCGCTTTCGGCGATTCAGAACACGCTCTCTGTTTGA

Retrieve as FASTA