Entry information : GluxDyPrx06
Entry ID 10204
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-04-03 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: GluxDyPrx06
Name GluxDyPrx06
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxDyPrx06
start..stop
S start..stop
GluxDyPrx04 800 0 1..516 1..532
GluxDyPrx07 756 0 1..515 1..499
GluxDyPrx03 734 0 1..515 1..515
GluxDyPrx08 723 0 1..515 1..508
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 707778..707940 163 N° 2 708001..708097 97 N° 3 708156..708601 446 N° 4 708662..708951 290
N° 5 709012..709234 223 N° 6 709300..709368 69 N° 7 709421..709487 67 N° 8 709547..709561 15
N° 9 709627..709630 4 N° 10 709756..709855 100 N° 11 709909..709985 77  
join(707778..707940,708001..708097,708156..708601,708662..708951,709012..709234, 709300..709368,709421..709487,709547..709561,709627..709630,709756..709855,70990 9..709985)


exon

Literature and cross-references GluxDyPrx06
DNA ref. JGI genome:   scaffold_16 (707778..709985)
Cluster/Prediction ref. JGI gene:   41146
Protein sequence: GluxDyPrx06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   516 (497)
PWM (Da):   %s   54673.13 (52657.0)  
PI (pH):   %s   6.08 (5.75) Peptide Signal:   %s   cut: 20 range:20-516
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKITLVSLFAVSAFQGVHSWPGSSFHFPPFSSPPSIPKFPCFSCKGQRNSSIFINPAAQPALPSAQQASNAAASAGLNLTDIQGDILVGMKKNKELFFFFSIANAQAFKSHLGADILPLITSTTQLLSVNTQPITTLNIAFSQNGLTAMGRTDNLGDSLFSNGQLSDASSLGDQTANWVSAFAGTDIDGVLLLASDTLDNVNNLLTQIQSTLGSSISEVYRIQGQARPGDQAGHHFGFMDGISNPAISGFSTPLPGQAVVAPGIILVGERGDGTRRPSWAKDGSFLAFRQLQQRVPEFNKFLRDNAPTEPNLSVDQNAELLGARMMGRWKGAPVDLAPLADDPALAADPQRNNNFNYTHAGFDFTTDQSHCPFSAHLRKTNPRADLGGNFPNHIMRAGIPYGPEVTDAEAASGSSSTDSNLERGLAFVAYQSSIATGFKFLQQTWANNPSFHTCNEGQDPIIGVAPGGGVRSSGGLNPQNTAHATTINDFVISRGGEYFFAPSLSAIQHTLSV

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCACACTCGTTTCGTTATTTGCAGTTTCTGCCTTCCAGGGCGTACATTCTTGGCCCGGTTCTAGTTTCCATTTTCCTCCTTTTTCAAGTCCTCCTTCTATTCCCAAGTTTCCA
TGTTTCTCTTGCAAAGGACAGCGAAATAGTTCGATCTTCATCA
GTAAGCATTTAATTCCGGACTCGGATGCATTGCAAGCATGGACGCTCACGAATTCTACAGATCCCGCCGCTCAGCCG
GCCCTACCCTCCGCTCAGCAGGCATCGAATGCTGCTGCTTCTGCAGGGTTGAATCTTACCGACATTCAGGGTGATATCCT
GTAAGTAATCTCTTTCCGATACTTGCTGTTGGTCGGATTG
ACTGATTCGGAACTCAAGTGTTGGAATGAAGAAAAACAAGGAGCTGTTTTTCTTCTTCAGCATCGCGAATGCTCAGGCCTTCAAGTCCCATCTCGGAGCAGATATTCTCCCTTTGATTAC
TTCGACCACCCAACTGCTCTCGGTGAACACGCAGCCCATTACCACTCTCAACATCGCCTTCTCTCAAAATGGCCTTACAGCTATGGGAAGGACGGACAACCTGGGCGACTCTCTCTTCTC
CAACGGACAGCTGTCTGATGCTTCGAGTCTTGGCGATCAAACCGCCAACTGGGTCTCAGCTTTTGCCGGTACCGATATTGACGGTGTCCTGCTCCTTGCCTCGGATACGTTAGACAATGT
GAACAATCTGCTCACTCAAATCCAGTCAACCTTAGGCAGTTCAATTTCGGAGGTTTATCGTATCCAAGGGCAGGCGAGGCCTGGGGATCAGGCAGGCCATGAAC
GTAAGATGGATTCCTT
CCATTAGGTTTTGAACGTTTCTGATTAAGGAATTGGTTGCTTAGATTTTGGGTTCATGGACGGAATCAGCAACCCAGCGATCTCCGGATTCTCGACGCCCCTTCCCGGTCAGGCAGTAGT
TGCACCAGGAATAATCCTAGTCGGAGAACGAGGTGACGGAACAAGACGTCCTTCCTGGGCTAAAGACGGCTCGTTCCTTGCCTTCCGTCAACTCCAACAGCGTGTCCCCGAGTTCAACAA
GTTCTTACGCGACAATGCTCCCACTGAACCTAACCTTTCTGTCGATCAGAACGCAGAGCTTCTTGGAGCTCGAATGATGGGACGATGGAAGAGT
GTGAGTACTGATCTGAACTTTTCCCG
AGCACTTGTTTATCGAGGTGTTGTCCTTTTATAGGGTGCTCCAGTCGATCTTGCCCCTCTTGCGGACGATCCCGCTTTGGCGGCGGATCCTCAACGGAATAACAACTTCAATTATACTCA
TGCAGGTTTCGACTTTACCACTGACCAATCTCACTGTCCTTTCTCCGCACATCTTCGAAAGACGAACCCTCGTGCAGACTTGGGGGGTAACTTCCCCAATCATATTATGCGGGCTGGGAT
TCCGTACGGACCTGAAG
GTAATGGTCATCCGTACAAGCTCGCCGGATAATAACTGCTCACAACATTCCGCTACACTCTTTAGTTACCGACGCCGAGGCTGCTTCTGGTTCTTCGAGCACG
GATTCTAACCTCGAGCGAGGGTTAGCCTTTG
GTATGCCTTGACTTGCATAACTTCATACCCTTATCTAAATTTCGGCCTACAGTCGCATACCAATCGTCTATCGCCACAGGTTTCAAATT
TCTTCAACAGACCTGGGCAAATAACCCATC
GTGAGTAGTGTGTAAATTTGATGTAGCAATACACTGACGTGTCTGTCCGTCTATCGCAGATTCCACACATGTAAGTAGCTTCAATCGGTC
TTTCGTTGAATCTCATCCTGACTGTCGGTACTTTCAATCGCAACTGTAGCGAAGTAAGTGCTCCATTCTCTCAAGCTTGCCACATTTCTGACAAAGCTTCTTCCTTCCTTCAACAGTGTC
GTGAGTACCAAATCCATCCAGTGATGGAATTTCTAAGTTTTCTGACTCCCTTCCGTAGGGTCAAGATCCCATTATCGGAGTCGCTCCGGGAGGAGGAGTTAGGAGCTCTGGTGGATTGAA
TCCACAGAACACGGCGCATGCTACTACCATAAATCAAG
GTATGCGTTTAATCTCTTTGAAAGAGTATTTGCAGATACTCATGCAATTGTAGACTTTGTTATTTCCCGAGGAGGAGAGTAC
TTCTTCGCTCCCTCTCTTTCGGCCATTCAGCATACGCTTTCTGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCACACTCGTTTCGTTATTTGCAGTTTCTGCCTTCCAGGGCGTACATTCTTGGCCCGGTTCTAGTTTCCATTTTCCTCCTTTTTCAAGTCCTCCTTCTATTCCCAAGTTTCCA
TGTTTCTCTTGCAAAGGACAGCGAAATAGTTCGATCTTCATCA
ATCCCGCCGCTCAGCCGGCCCTACCCTCCGCTCAGCAGGCATCGAATGCTGCTGCTTCTGCAGGGTTGAATCTTACC
GACATTCAGGGTGATATCCT
TGTTGGAATGAAGAAAAACAAGGAGCTGTTTTTCTTCTTCAGCATCGCGAATGCTCAGGCCTTCAAGTCCCATCTCGGAGCAGATATTCTCCCTTTGATT
ACTTCGACCACCCAACTGCTCTCGGTGAACACGCAGCCCATTACCACTCTCAACATCGCCTTCTCTCAAAATGGCCTTACAGCTATGGGAAGGACGGACAACCTGGGCGACTCTCTCTTC
TCCAACGGACAGCTGTCTGATGCTTCGAGTCTTGGCGATCAAACCGCCAACTGGGTCTCAGCTTTTGCCGGTACCGATATTGACGGTGTCCTGCTCCTTGCCTCGGATACGTTAGACAAT
GTGAACAATCTGCTCACTCAAATCCAGTCAACCTTAGGCAGTTCAATTTCGGAGGTTTATCGTATCCAAGGGCAGGCGAGGCCTGGGGATCAGGCAGGCCATGAAC
ATTTTGGGTTCATG
GACGGAATCAGCAACCCAGCGATCTCCGGATTCTCGACGCCCCTTCCCGGTCAGGCAGTAGTTGCACCAGGAATAATCCTAGTCGGAGAACGAGGTGACGGAACAAGACGTCCTTCCTGG
GCTAAAGACGGCTCGTTCCTTGCCTTCCGTCAACTCCAACAGCGTGTCCCCGAGTTCAACAAGTTCTTACGCGACAATGCTCCCACTGAACCTAACCTTTCTGTCGATCAGAACGCAGAG
CTTCTTGGAGCTCGAATGATGGGACGATGGAAGAGT
GGTGCTCCAGTCGATCTTGCCCCTCTTGCGGACGATCCCGCTTTGGCGGCGGATCCTCAACGGAATAACAACTTCAATTATACT
CATGCAGGTTTCGACTTTACCACTGACCAATCTCACTGTCCTTTCTCCGCACATCTTCGAAAGACGAACCCTCGTGCAGACTTGGGGGGTAACTTCCCCAATCATATTATGCGGGCTGGG
ATTCCGTACGGACCTGAAG
TTACCGACGCCGAGGCTGCTTCTGGTTCTTCGAGCACGGATTCTAACCTCGAGCGAGGGTTAGCCTTTGTCGCATACCAATCGTCTATCGCCACAGGTTTC
AAATTTCTTCAACAGACCTGGGCAAATAACCCATC
ATTCCACACATGTAACGAAGGTCAAGATCCCATTATCGGAGTCGCTCCGGGAGGAGGAGTTAGGAGCTCTGGTGGATTGAATCCA
CAGAACACGGCGCATGCTACTACCATAAATCAAG
ACTTTGTTATTTCCCGAGGAGGAGAGTACTTCTTCGCTCCCTCTCTTTCGGCCATTCAGCATACGCTTTCTGTTTGA

Retrieve as FASTA