Entry information : GluxDyPrx08
Entry ID 10206
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-04-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-27 (Christophe Dunand)
Peroxidase information: GluxDyPrx08
Name GluxDyPrx08
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxDyPrx08
start..stop
S start..stop
GluxDyPrx07 828 0 1..509 1..500
GluxDyPrx03 801 0 1..509 1..516
GluxDyPrx04 708 0 1..509 1..532
GluxDyPrx06 707 0 1..508 1..515
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 275248..275362 115 N° 2 275103..275199 97 N° 3 274595..275046 452 N° 4 274246..274535 290
N° 5 273965..274190 226 N° 6 273831..273899 69 N° 7 273709..273775 67 N° 8 273334..273470 137
N° 9 273201..273277 77  
complement(join(273201..273277,273334..273470,273709..273775,273831..273899,2739 65..274190,274246..274535,274595..275046,275103..275199,275248..275362))


exon

Literature and cross-references GluxDyPrx08
DNA ref. JGI genome:   scaffold_71 (275362..273201)
Cluster/Prediction ref. JGI gene:   1024286
Protein sequence: GluxDyPrx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   509 (490)
PWM (Da):   %s   54252.09 (52110.0)  
PI (pH):   %s   4.31 (4.24) Peptide Signal:   %s   cut: 20 range:20-509
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKFTHFSLLAAFALQSVYSVPNLPSDALKPRRTSSILINPPAQPPLPSVQEAASASASVGLNLTNIQGDILIGMKKNKELFFFFSIVDPTSFKAQLGADILPFITSTTQVLDVSTQPETLVNIAFSQKGLTELGITDNLGDTLFAAGQLNDASNLGDTTSDWVSEFIDPNNLLHGVLLLASDATDNINSTLSQIQNALNGSISEVYSIQGQARPGDQQGHHFGFMDGISNPAIAGFSTQLPGQALVAPGIILVGEGGDGTARPSWATDGSFLAFRQLEQRVPEFTKFLIDNALSEPNLTADQNAELLGARMMGRWKGAPIDLTPLADDPVLAADPQQNNNFNYSHPGFNITTDQSHCPFSAHVRKTNPRLDLNNANFTNHIIRAGIPYGPEVTDAEAASNTSSTDPSLERGLAFVAYQSSIGTGFAFLQQKWANNANDKNCASSYSLPQGQDPIIGIAPEDGPRSVGGLDPLDPTRDITMNDFVISRGGEYFFSPSLSAIQNTLSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTCACACACTTTTCGTTATTAGCGGCCTTTGCACTGCAAAGTGTGTATTCTGTCCCAAATCTTCCATCCGATGCTCTGAAACCACGACGAACGAGCTCGATTCTCATCAGTAAG
TATCCAGGAGAATCGTAAAGCTAAATACTTATGAAGTCTACAGATCCCCCTGCCCAACCTCCCCTACCTTCCGTTCAGGAGGCAGCGAGTGCTTCCGCGTCGGTGGGCTTAAACCTCACC
AACATTCAGGGAGATATTCT
GTAAGCACCTTGTAATAGTCATTCCATCCAGTCTGCTGTCTGACTTGAGATCAAAGTATCGGAATGAAGAAAAACAAAGAGTTATTCTTCTTTTTCAGCA
TTGTGGACCCGACATCCTTCAAGGCCCAACTAGGAGCGGATATTCTCCCTTTTATCACTTCGACTACCCAAGTGCTCGACGTTAGCACGCAACCCGAAACTCTTGTGAACATTGCCTTCT
CTCAGAAGGGCCTTACAGAATTGGGAATAACAGACAACCTTGGCGACACTCTCTTTGCAGCCGGGCAATTGAATGACGCTTCGAATCTGGGTGATACAACCAGCGACTGGGTTTCGGAGT
TTATTGATCCCAATAACCTACTCCACGGTGTTCTCCTCCTCGCCTCAGATGCGACAGATAATATAAACAGCACGCTTTCCCAAATTCAAAATGCCTTGAACGGTTCAATTTCTGAAGTTT
ATAGCATTCAGGGTCAGGCGAGGCCCGGAGATCAGCAAGGCCACGAAC
GTATGATATTTTTCCTCCATCTCAATATGTGCAATTGTGACTGAAGTACCGCTATACAGACTTTGGATTCAT
GGATGGAATCAGCAACCCAGCAATCGCCGGGTTCTCTACACAACTCCCAGGTCAAGCACTTGTTGCACCGGGCATTATTCTAGTTGGAGAAGGGGGCGACGGAACGGCACGTCCTTCTTG
GGCTACAGACGGCTCGTTCCTTGCCTTCCGTCAGCTTGAACAGCGTGTTCCCGAGTTCACCAAGTTTTTGATTGACAATGCTCTTTCTGAACCCAATCTAACTGCCGATCAGAATGCGGA
ACTTCTTGGAGCTCGAATGATGGGGCGATGGAAGAGT
GTAACAGTTATCCATGTTTTTACCGAGTTTTTACTAACCAGACATCCTTCGTTAGGGAGCTCCAATTGATCTTACTCCACTTG
CGGACGATCCTGTTCTTGCGGCGGATCCTCAACAAAACAACAACTTCAACTATTCTCATCCAGGTTTCAATATAACCACCGACCAATCTCACTGCCCATTCTCGGCGCATGTCCGCAAGA
CCAATCCCCGTTTAGACTTGAATAACGCAAATTTCACCAATCATATTATTCGTGCCGGCATCCCTTATGGACCCGAAG
GTACGTTCTGCATCGGTTCTGCACTTTACCGGATACTCGTTG
CTCATGATGGTCCAACTATGTAGTTACTGACGCCGAAGCTGCTTCCAACACTTCGAGCACAGATCCTTCTCTCGAGCGAGGTTTAGCTTTTGGTAAGATAATTCGATACATGCGCGGGAT
CCGAGTTCAATAAAATTTGTTATTCAGTTGCATATCAATCGTCCATTGGCACAGGATTTGCATTCCTCCAGCAAAAATGGGCAAATAACGCTAAGTGAGCAGTGAATATTTTGACCCCAT
AACAGATGCTGATTCCTCTTCACAGCTTCCACTTCTGTGAGTGTTTCCATTTGTCAATTTGAATTCACCTTAATAACAGCTTCTTCTTTGTCTCGTAATTGCAGCGGGGTATGTACTCAC
TCCTTTTCCAAGTTTTTCAATGTTTCTGACAGTCGCTTCCCTATATTCCTTCTTCTCCTTCATTTAGCATTGTAAGTACCAGACTTTTCGAGTGATAAGAATTGTGCATCATCTTACTCC
CTTCCGCAGGGTCAAGATCCTATTATTGGCATCGCTCCTGAAGACGGACCTAGAAGTGTAGGAGGACTTGATCCTTTGGACCCAACGAGGGATATTACTATGAATCAGG
GTATAGACTCA
AGCTTGCTGTGTAACAGTGATACTAGAAGGCTCATACTCGTTTAGATTTCGTCATTTCCCGAGGAGGAGAATACTTCTTCTCGCCCTCTCTTTCGGCCATCCAGAACACGCTATCTGCTT
AG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTCACACACTTTTCGTTATTAGCGGCCTTTGCACTGCAAAGTGTGTATTCTGTCCCAAATCTTCCATCCGATGCTCTGAAACCACGACGAACGAGCTCGATTCTCATCAATCCC
CCTGCCCAACCTCCCCTACCTTCCGTTCAGGAGGCAGCGAGTGCTTCCGCGTCGGTGGGCTTAAACCTCACCAACATTCAGGGAGATATTCT
TATCGGAATGAAGAAAAACAAAGAGTTA
TTCTTCTTTTTCAGCATTGTGGACCCGACATCCTTCAAGGCCCAACTAGGAGCGGATATTCTCCCTTTTATCACTTCGACTACCCAAGTGCTCGACGTTAGCACGCAACCCGAAACTCTT
GTGAACATTGCCTTCTCTCAGAAGGGCCTTACAGAATTGGGAATAACAGACAACCTTGGCGACACTCTCTTTGCAGCCGGGCAATTGAATGACGCTTCGAATCTGGGTGATACAACCAGC
GACTGGGTTTCGGAGTTTATTGATCCCAATAACCTACTCCACGGTGTTCTCCTCCTCGCCTCAGATGCGACAGATAATATAAACAGCACGCTTTCCCAAATTCAAAATGCCTTGAACGGT
TCAATTTCTGAAGTTTATAGCATTCAGGGTCAGGCGAGGCCCGGAGATCAGCAAGGCCACGAAC
ACTTTGGATTCATGGATGGAATCAGCAACCCAGCAATCGCCGGGTTCTCTACACAA
CTCCCAGGTCAAGCACTTGTTGCACCGGGCATTATTCTAGTTGGAGAAGGGGGCGACGGAACGGCACGTCCTTCTTGGGCTACAGACGGCTCGTTCCTTGCCTTCCGTCAGCTTGAACAG
CGTGTTCCCGAGTTCACCAAGTTTTTGATTGACAATGCTCTTTCTGAACCCAATCTAACTGCCGATCAGAATGCGGAACTTCTTGGAGCTCGAATGATGGGGCGATGGAAGAGT
GGAGCT
CCAATTGATCTTACTCCACTTGCGGACGATCCTGTTCTTGCGGCGGATCCTCAACAAAACAACAACTTCAACTATTCTCATCCAGGTTTCAATATAACCACCGACCAATCTCACTGCCCA
TTCTCGGCGCATGTCCGCAAGACCAATCCCCGTTTAGACTTGAATAACGCAAATTTCACCAATCATATTATTCGTGCCGGCATCCCTTATGGACCCGAAG
TTACTGACGCCGAAGCTGCT
TCCAACACTTCGAGCACAGATCCTTCTCTCGAGCGAGGTTTAGCTTTTG
TTGCATATCAATCGTCCATTGGCACAGGATTTGCATTCCTCCAGCAAAAATGGGCAAATAACGCTAATGAT
AAGAATTGTGCATCATCTTACTCCCTTCCGCAGGGTCAAGATCCTATTATTGGCATCGCTCCTGAAGACGGACCTAGAAGTGTAGGAGGACTTGATCCTTTGGACCCAACGAGGGATATT
ACTATGAATCAGG
ATTTCGTCATTTCCCGAGGAGGAGAATACTTCTTCTCGCCCTCTCTTTCGGCCATCCAGAACACGCTATCTGCTTAG

Retrieve as FASTA