Entry information : OsPrx11
Entry ID 1021
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx11
Name OsPrx11
Class Class III peroxidase    [Orthogroup: Prx082]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx11
start..stop
S start..stop
ZmPrx107 598 0 1..345 1..345
ZmPrx44 593 0 1..345 1..345
SbPrx58 574 0 1..345 1..345
BdiPrx61 564 0 1..345 1..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10747995..10748222 228 N° 2 10746968..10747783 816  
complement(join(10746968..10747783,10747995..10748222))


exon

Literature and cross-references OsPrx11
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9FYP0
DNA ref. GenBank:   NC_008394.1 (10748222..10746971)
Protein sequence: OsPrx11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347
PWM (Da):   %s   37726.25 Transmb domain:   %s   i7-29o
PI (pH):   %s   6.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSVAILCALVAVQAAALLLAGSAAAASELKVGYYHKKCKGVENVIKWHVIKALKQNRRTGAALVRLLFHDCFVRGCDGSVLLDKSYENPHPEKEAPVNIGLAAFDLLEEIKAAVEKRCPGVVSCSDILIYAARDAGSILSNGHVHFDVPAGRLDGVVSRADEAQAELPDSTMTVQQLKDNFAAKGFDTEQLVILSGAHSIGQGHCSSFTGRLSEPPQQITPAYRDLLNYKCSQAANPDVVNNVRDEDASVVARFMPGFVSRVRKISDFLDNTYYHNNLAKIVTFHSDWQLLTDATSLSKVHEYADNATLWDSDFSDSLLKLSQLPMPEGSKGEIRKKCSAINHLY*

Retrieve as FASTA  
Remarks chromosome 1. 28 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTGTCGGTGGCCATCCTCTGCGCCCTCGTCGCCGTGCAGGCGGCGGCGCTGCTCCTCGCCGGATCGGCGGCCGCGGCCAGCGAGCTCAAGGTCGGGTACTACCACAAGAAGTGC
AAGGGCGTCGAGAACGTGATCAAGTGGCACGTCATCAAGGCTCTCAAGCAGAACCGCCGCACCGGCGCTGCCCTAGTCCGCCTCCTCTTCCACGACTGCTTCGTCAGG
GTACATAAAATA
TCATTACTACTACTATTTCTGTTTCTTTTTCGTAACGTTTGTTAGTTAAAAATAAATTAACCTCAGCTATATATTTTGAAACGGAGGAAGTACATGTGGAGAAGCTAGATGATCATCTCA
ACTGATCTAGCTACTTACATAGCTTAGTTCCAACTTTCAAGCATTGTGGATTAATGCAATTATGTATTTATGTATGCAGGGTTGCGATGGGTCAGTCCTGCTGGACAAGTCGTACGAGAA
CCCACACCCGGAGAAGGAGGCGCCGGTGAACATCGGGCTGGCGGCGTTCGACCTCCTGGAGGAGATCAAGGCGGCCGTGGAGAAGCGGTGCCCCGGCGTGGTGTCCTGCTCCGACATCCT
CATCTACGCGGCGCGCGACGCCGGCAGCATCCTCAGCAACGGCCACGTCCACTTCGACGTCCCCGCGGGCCGCCTCGACGGCGTCGTCTCCAGGGCCGACGAGGCCCAGGCGGAGCTCCC
GGACTCCACCATGACCGTGCAGCAGCTCAAGGACAACTTCGCCGCCAAGGGCTTCGACACCGAGCAGCTGGTCATCCTCTCCGGCGCGCACTCCATCGGCCAGGGCCACTGCTCCTCCTT
CACCGGCCGCCTCTCCGAGCCGCCGCAGCAGATCACCCCGGCGTACCGCGACCTCCTCAACTACAAGTGCTCCCAGGCCGCCAACCCGGACGTCGTCAACAACGTCCGCGACGAGGACGC
CTCCGTCGTCGCCAGGTTCATGCCGGGCTTCGTCAGCCGCGTCCGCAAGATCAGCGACTTCCTCGACAACACCTACTACCACAACAACCTCGCCAAGATCGTCACCTTCCACTCCGACTG
GCAGCTGCTCACGGACGCCACGTCGCTCTCCAAGGTCCACGAGTACGCCGACAATGCCACCCTTTGGGACTCCGACTTCTCCGACTCGCTGCTCAAGCTCAGCCAGCTGCCCATGCCGGA
GGGGAGCAAGGGGGAGATCAGGAAGAAGTGCAGCGCCATCAACCACTTGTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTGTCGGTGGCCATCCTCTGCGCCCTCGTCGCCGTGCAGGCGGCGGCGCTGCTCCTCGCCGGATCGGCGGCCGCGGCCAGCGAGCTCAAGGTCGGGTACTACCACAAGAAGTGC
AAGGGCGTCGAGAACGTGATCAAGTGGCACGTCATCAAGGCTCTCAAGCAGAACCGCCGCACCGGCGCTGCCCTAGTCCGCCTCCTCTTCCACGACTGCTTCGTCAGG
GGTTGCGATGGG
TCAGTCCTGCTGGACAAGTCGTACGAGAACCCACACCCGGAGAAGGAGGCGCCGGTGAACATCGGGCTGGCGGCGTTCGACCTCCTGGAGGAGATCAAGGCGGCCGTGGAGAAGCGGTGC
CCCGGCGTGGTGTCCTGCTCCGACATCCTCATCTACGCGGCGCGCGACGCCGGCAGCATCCTCAGCAACGGCCACGTCCACTTCGACGTCCCCGCGGGCCGCCTCGACGGCGTCGTCTCC
AGGGCCGACGAGGCCCAGGCGGAGCTCCCGGACTCCACCATGACCGTGCAGCAGCTCAAGGACAACTTCGCCGCCAAGGGCTTCGACACCGAGCAGCTGGTCATCCTCTCCGGCGCGCAC
TCCATCGGCCAGGGCCACTGCTCCTCCTTCACCGGCCGCCTCTCCGAGCCGCCGCAGCAGATCACCCCGGCGTACCGCGACCTCCTCAACTACAAGTGCTCCCAGGCCGCCAACCCGGAC
GTCGTCAACAACGTCCGCGACGAGGACGCCTCCGTCGTCGCCAGGTTCATGCCGGGCTTCGTCAGCCGCGTCCGCAAGATCAGCGACTTCCTCGACAACACCTACTACCACAACAACCTC
GCCAAGATCGTCACCTTCCACTCCGACTGGCAGCTGCTCACGGACGCCACGTCGCTCTCCAAGGTCCACGAGTACGCCGACAATGCCACCCTTTGGGACTCCGACTTCTCCGACTCGCTG
CTCAAGCTCAGCCAGCTGCCCATGCCGGAGGGGAGCAAGGGGGAGATCAGGAAGAAGTGCAGCGCCATCAACCACTTGTACTAA

Retrieve as FASTA