Entry information : BbotDyPrx03
Entry ID 10217
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-11 (Christophe Dunand)
Peroxidase information: BbotDyPrx03
Name BbotDyPrx03
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Botryobasidiaceae Botryobasidium
Organism Botryobasidium botryosum    [TaxId: 264124 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BbotDyPrx03
start..stop
S start..stop
FmeDyPrx01 568 0 36..518 5..469
FmeDyPrx03 499 1e-174 36..518 2..473
FmeDyPrx02 489 1e-170 56..518 20..470
TvDyPrx01 468 4e-162 56..517 19..482
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 747690..747853 164 N° 2 747959..748178 220 N° 3 748248..748403 156 N° 4 748470..748604 135
N° 5 748661..748833 173 N° 6 748900..749205 306 N° 7 749245..749489 245 N° 8 749560..749717 158
join(747690..747853,747959..748178,748248..748403,748470..748604,748661..748833, 748900..749205,749245..749489,749560..749717)


exon

Literature and cross-references BbotDyPrx03
DNA ref. JGI genome:   scaffold_9 (747690..749717)
Cluster/Prediction ref. JGI gene:   106029 [Incorrect prediction]
Protein sequence: BbotDyPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   518
PWM (Da):   %s   55963.44  
PI (pH):   %s   8.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSPAKKSFLQRIFQSFQAPAPPTTPPSTTPPASWPTQQDLDDLQGKPFYYSSLGLPKRYEVFIFFTIQDVAGFKKALSQVIPLITTTAQIQRFRSEIAHHKRNKGEGLLKFAGTNIGFSQTGLTLGITDSLGDPAFTAGQLASAKALGDDGTTDASNNFTPNWLPEFKGDTHGIILIGGDSFASVNEAADKVEYILGGTIKAILKVQANARPGKEKGHEHFGYLDGISFPAIPALTGQLPGQQVVQPGVLVCGEDGDVDTTTKQPVVRPSWAVNGSFLVYRHLNQLVPEFNEFVRDNALNTTGTMTQEQGAELLGARFFGRWKSGAPIDIAPTQDNPVLAADPKRNNNFNFSGQDVLDQTRCPFSAHIRKTNPRNDLAQYVFGPTAVSQHMINRQSIAFGPEVTPQEAQTGKTIETRGLSFVCYQSNLANGFEFVQKAWADTTTFPPKTINGAQFDPGFDPIGQANGAPRQVAGMDPNNQSKNLTLPSHFVASKGGQYFFSPSITALKTKFAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns. ). Incorrect prediction from JGI (first exon is not predicted).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACGTCCTCTCCCGCTAAGAAATCCTTCCTTCAGCGTATATTCCAAAGCTTTCAAGCTCCAGCACCTCCTACCACACCACCAAGTACTACTCCTCCTGCCTCTTGGCCCACTCAA
CAAGACCTTGACGATCTTCAAGGTAAACCATTTTACTACTCCTC
GTGAAATATACGCTGCGAGACTGACTTATTAATTTAACCGTAGGCGATGTAGTGTAAGAGCTACTTGCCTGTCGGT
TGCATCCCTTACTTACCAATAACACTTAGTCTCGGACTCCCCAAGCGCTACGAAGTTTTCATTTTCTTTACCATCCAAGATGTCGCCGGTTTCAAGAAGGCGCTCAGCCAGGTCATCCCC
TTGATCACAACAACTGCGCAGATCCAAAGGTTCCGCTCCGAAATCGCCCACCACAAGCGCAACAAAGGCGAAGGCCTGCTTAAATTCGCTGGCACCAATATAGGATTCAGCCAGACAGGG
CTCACTAAG
GTATACAGCGTTCCATAGCAAGGACATCGAGGACAATTTCCTAGTTTGACCGTATGGCCTTTCTGATAGCTCGGGATTACGGATTCGCTTGGAGACCCTGCCTTCACCGCC
GGCCAGCTCGCAAGCGCAAAGGCGCTCGGAGACGATGGAACTACCGATGCAAGCAACAATTTCACGCCCAATTGGCTCCCTGAGTTCAAGGGTGATACCCACGGTATTATTCTA
GTAGGT
ACCCGGTCCAGCCATATATCTCTTGCTTCGTGCAGCTTTAACCGTCTCGTCTCGCCATAGATTGGAGGTGACTCGTTTGCTTCCGTGAACGAAGCCGCCGATAAAGTAGAGTACATCCTC
GGAGGCACGATCAAAGCGATCCTCAAGGTTCAGGCTAATGCCCGTCCTGGAAAGGAGAAGGGCCATGAACACTTT
GTATGTCACGCTCCATCTTGTTTTCTCCAAGCGCCTACTTAGCAT
AAACTCGCAAGGGTTACTTGGATGGCATCTCCTTCCCGGCTATCCCCGCTTTGACAGGCCAACTACCCGGTCAGCAGGTCGTCCAACCTGGCGTTTTGGTCTGTGGTGAGGATGGGGACG
TGGACACCACCACCAAGCAGCCAGTCGTTCGTCCCTCTTGGGCAGTGAATGGATCTTTCCTCGT
GTTAGTATCTCCTCGAACCTCAAACCTCCATTCCTACACCCACTTACCCTCGCGTC
TATTGTGCAGTTATCGCCACCTGAACCAGCTTGTGCCCGAGTTCAACGAATTCGTGCGCGACAATGCGCTCAATACCACCGGCACGATGACACAAGAACAAGGTGCCGAGTTGCTCGGTG
CAAGGTTCTTCGGGAGGTGGAAGAGCGGCGCACCAATCGACATCGCACCCACCCAAGACAATCCTGTACTTGCAGCGGACCCAAAACGCAATAACAACTTTAATTTCAGCGGACAGGATG
TGCTAGATCAGACGCGTTGTCCGTTCTCAGCACACATCCGGAAGACAAACCCAAGGAATGACCTTGCGCAGTATGT
GTAAACGCTCTCGACTATGTTTCCTCGACTTTCACGTAGATTTG
GCCCGACTGCAGTGTCTCAGCATATGATCAACAGGCAAAGTATTGCCTTTGGACCCGAAGTCACGCCGCAGGAGGCACAAACGGGCAAGACGATCGAGACCCGCGGGCTCTCTTTCGTGT
GCTACCAGAGCAATCTCGCAAACGGATTCGAATTTGTGCAAAAGGCCTGGGCGGATACCACGACATTCCCACCCAAGACTATCAACGGTGCGCAGTTCGACCCCGGCTTCGACCCGATTA
GTGCGTACACATTCATTCGAATTCCCAGAGCGAATAGAAACGCTAACTAACATTTCATATCGGAAAACAGTCGGCCAGGCCAACGGCGCGCCGCGTCAAGTGGCTGGCATGGATCCGAAC
AACCAGTCAAAGAACCTCACGTTGCCGTCCCACTTCGTAGCGTCGAAGGGCGGGCAGTATTTCTTCTCCCCATCAATCACTGCGCTGAAGACTAAGTTCGCAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACGTCCTCTCCCGCTAAGAAATCCTTCCTTCAGCGTATATTCCAAAGCTTTCAAGCTCCAGCACCTCCTACCACACCACCAAGTACTACTCCTCCTGCCTCTTGGCCCACTCAA
CAAGACCTTGACGATCTTCAAGGTAAACCATTTTACTACTCCTC
TCTCGGACTCCCCAAGCGCTACGAAGTTTTCATTTTCTTTACCATCCAAGATGTCGCCGGTTTCAAGAAGGCGCTC
AGCCAGGTCATCCCCTTGATCACAACAACTGCGCAGATCCAAAGGTTCCGCTCCGAAATCGCCCACCACAAGCGCAACAAAGGCGAAGGCCTGCTTAAATTCGCTGGCACCAATATAGGA
TTCAGCCAGACAGGGCTCACTAAG
CTCGGGATTACGGATTCGCTTGGAGACCCTGCCTTCACCGCCGGCCAGCTCGCAAGCGCAAAGGCGCTCGGAGACGATGGAACTACCGATGCAAGC
AACAATTTCACGCCCAATTGGCTCCCTGAGTTCAAGGGTGATACCCACGGTATTATTCTA
ATTGGAGGTGACTCGTTTGCTTCCGTGAACGAAGCCGCCGATAAAGTAGAGTACATCCTC
GGAGGCACGATCAAAGCGATCCTCAAGGTTCAGGCTAATGCCCGTCCTGGAAAGGAGAAGGGCCATGAACACTTT
GGTTACTTGGATGGCATCTCCTTCCCGGCTATCCCCGCTTTGACA
GGCCAACTACCCGGTCAGCAGGTCGTCCAACCTGGCGTTTTGGTCTGTGGTGAGGATGGGGACGTGGACACCACCACCAAGCAGCCAGTCGTTCGTCCCTCTTGGGCAGTGAATGGATCT
TTCCTCGT
TTATCGCCACCTGAACCAGCTTGTGCCCGAGTTCAACGAATTCGTGCGCGACAATGCGCTCAATACCACCGGCACGATGACACAAGAACAAGGTGCCGAGTTGCTCGGTGCA
AGGTTCTTCGGGAGGTGGAAGAGCGGCGCACCAATCGACATCGCACCCACCCAAGACAATCCTGTACTTGCAGCGGACCCAAAACGCAATAACAACTTTAATTTCAGCGGACAGGATGTG
CTAGATCAGACGCGTTGTCCGTTCTCAGCACACATCCGGAAGACAAACCCAAGGAATGACCTTGCGCAGTATGT
ATTTGGCCCGACTGCAGTGTCTCAGCATATGATCAACAGGCAAAGT
ATTGCCTTTGGACCCGAAGTCACGCCGCAGGAGGCACAAACGGGCAAGACGATCGAGACCCGCGGGCTCTCTTTCGTGTGCTACCAGAGCAATCTCGCAAACGGATTCGAATTTGTGCAA
AAGGCCTGGGCGGATACCACGACATTCCCACCCAAGACTATCAACGGTGCGCAGTTCGACCCCGGCTTCGACCCGATTA
TCGGCCAGGCCAACGGCGCGCCGCGTCAAGTGGCTGGCATG
GATCCGAACAACCAGTCAAAGAACCTCACGTTGCCGTCCCACTTCGTAGCGTCGAAGGGCGGGCAGTATTTCTTCTCCCCATCAATCACTGCGCTGAAGACTAAGTTCGCAGCTTGA

Retrieve as FASTA