Entry information : CzmDyPrx
Entry ID 10218
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: CzmDyPrx
Name CzmDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Cercospora
Organism Cercospora zeae-maydis    [TaxId: 135779 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CzmDyPrx
start..stop
S start..stop
NcDyPrx 630 0 5..506 4..506
NtetDyPrx01_2509 622 0 5..506 4..506
BfuDyPrx 615 0 5..506 4..506
NdisDyPrx 611 0 5..506 4..511
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42276..42322 47 N° 2 41949..42214 266 N° 3 41558..41882 325 N° 4 41386..41493 108
N° 5 41215..41325 111 N° 6 40754..41163 410 N° 7 40409..40686 278  
complement(join(40409..40686,40754..41163,41215..41325,41386..41493,41558..41882 ,41949..42214,42276..42322))


exon

Literature and cross-references CzmDyPrx
DNA ref. JGI genome:   scaffold_3 (42322..40409)
Cluster/Prediction ref. JGI gene:   109101
Protein sequence: CzmDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   515
PWM (Da):   %s   57086.78  
PI (pH):   %s   7.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASVIRKTNIQGDIWPGLPKRFQSFLFFQIQKPALFKSRLKQFASDGHITTAAQACEMKDLIAGAQKLYKSSGKRAPLLPLPGVNIAFSSSGLHKVGKLTISGSVQTDPVMSKIFRRNQLRGAQFEVGMFEDLVGEGWDNPQDLRPEYQPSHAAGSNHRQIDGVLLVTSSVESDILEQIKNVTQHFLDDGVVSFPLVREGHVRPGDAKGKEHFGFADGISQPFIQGLDDTVPNAKLPKDKEPKASDAGLILCGHKGDPMKQPSWSHDGSFLVIRDLQQMVPEFEEWLQKNGPKAPFCQGSDKPAEKLAAYLMGRWRNGTPVHESPHSDEDESLHASNAFDYEPRDKHDKCPFAAHTRKMRPRSDLGHDHAVIIRRGIPYGPEVSDEEKAAKTSDTAAERERGLLFACYQSDIRNGFNFLTTRWASQHHFPTNKHESVGEEGPGIDPIVGQRLDHHPPRLIALPDGQVPTKHRMELESWVTHKGGEYFFSPSIEAIMGYLTGPSDYDLAPRAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGTCGGTCATCAGGAAGACCAACATCCAAGGCGACATATGGCAAGTCCTCCTGTCACTTTTCTCTACCAGTGGAGAACTGGCTAATATTCGTTGATACCAGGCCCGGACTACC
CAAGAGGTTTCAATCCTTTCTGTTTTTCCAGATCCAGAAACCGGCTCTATTCAAATCTCGACTGAAACAGTTTGCGAGCGATGGTCACATTACTACTGCCGCACAAGCATGCGAGATGAA
GGATTTGATAGCAGGCGCACAAAAGTTATACAAGAGCTCTGGGAAAAGGGCTCCATTACTACCCCTCCCTGGTGTTAATATCGCGTTCTCATCGTCAGGCCTGCATAAGGTGGGTAAATT
GACTATCTCTGGCT
GTCCAGCACTGACTCTACCATTCTGTATGTAGCTCGGCAAGTTTGTGCAAACTTCCGACCAACAAGCCGTCCAGACGGACCCAGTCATGTCGAAGATCTTCCGACG
GAACCAACTGCGGGGCGCCCAATTTGAAGTCGGCATGTTCGAGGACCTGGTAGGCGAGGGATGGGATAATCCACAAGACCTTCGGCCAGAGTACCAGCCTTCTCACGCCGCCGGGAGCAA
TCATCGTCAGATCGATGGCGTGCTTCTAGTTACCTCCAGTGTTGAATCGGATATCTTGGAGCAAATCAAGAATGTTACTCAGCACTTTCTGGACGATGGAGTTGTTTCATTTCCCTTGGT
GAGAGAGGGTCACGTCCGACCTGGAGATGCCAAAGGTAAAGAGCA
GTAAGTGCTGAGGATTCAAGCGCTTTCTGCTAAGCTTTGTACTGATCTTTGTCCATCTGGACAGTTTTGGGTTTG
CAGATGGAATCAGCCAGCCTTTCATCCAAGGCTTGGACGATACTGTTCCCAACGCGAAATTGCCCAAGGACAAGGAGCCGAAGGCTTCCGACGCAGG
GTGAGTTCACAAACATTGGACTG
ACGACATTCTTCAGCTCGCTAACTTGTGTATCCATAGGTTAATTCTGTGTGGACACAAAGGCGATCCAATGAAGCAGCCGTCATGGAGCCACGATGGTAGCTTCCTTGTGATTAGAGATC
TGCAGCAGATGGTCCCCGAATTCGAAGA
GTGAGCCATGTCTGCCAAATTTGTTGAAAACAAGGTCTTACGCATGATTAGATGGCTCCAGAAAAATGGCCCCAAGGCTCCTTTCTGCCAAG
GCTCCGATAAGCCAGCAGAAAAGCTTGCGGCATATCTGATGGGCAGATGGAGGAACGGAACACCTGTCCACGAGAGCCCCCACAGCGACGAGGACGAGAGCTTACACGCATCCAATGCCT
TCGACTACGAGCCTCGAGACAAGCATGACAAGTGTCCGTTCGCGGCCCACACGCGAAAAATGCGGCCGAGGTCAGATCTTGGCCATGATCACGCAGTGATTATCCGACGCGGGATCCCGT
ATGGGCCTGAAGTCAGCGATGAAGAGAAGGCAGCCAAGACCTCGGACACTGCTGCAGAGCGTGAACGCGGTCTACTCTTTGCTTGCTACCAAAGTGATATTCGCAACGGATTCAATTTCC
TGACAACTC
GTAAGTGTGCTACCATCTTAGCCATCAGAGTGAGCCCCATAAGCTGACAGAATGTGATCTTCTCAAGGCTGGGCCAGTCAACACCATTTCCCCACGAACAAGCATGAATCC
GTCGGCGAGGAAGGCCCAGGCATCGACCCCATCGTTGGCCAAAGACTCGACCACCATCCACCGCGATTGATCGCTTTGCCTGACGGCCAAGTCCCTACCAAGCACCGAATGGAACTCGAA
AGCTGGGTCACTCACAAAGGTGGTGAATATTTTTTCAGCCCATCTATCGAAGCCATCATGGGCTACCTAACAGGACCAAGCGACTACGACTTGGCACCTAGGGCGAAATTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGTCGGTCATCAGGAAGACCAACATCCAAGGCGACATATGGCCCGGACTACCCAAGAGGTTTCAATCCTTTCTGTTTTTCCAGATCCAGAAACCGGCTCTATTCAAATCTCGA
CTGAAACAGTTTGCGAGCGATGGTCACATTACTACTGCCGCACAAGCATGCGAGATGAAGGATTTGATAGCAGGCGCACAAAAGTTATACAAGAGCTCTGGGAAAAGGGCTCCATTACTA
CCCCTCCCTGGTGTTAATATCGCGTTCTCATCGTCAGGCCTGCATAAGGTGGGTAAATTGACTATCTCTGGCT
CCGTCCAGACGGACCCAGTCATGTCGAAGATCTTCCGACGGAACCAA
CTGCGGGGCGCCCAATTTGAAGTCGGCATGTTCGAGGACCTGGTAGGCGAGGGATGGGATAATCCACAAGACCTTCGGCCAGAGTACCAGCCTTCTCACGCCGCCGGGAGCAATCATCGT
CAGATCGATGGCGTGCTTCTAGTTACCTCCAGTGTTGAATCGGATATCTTGGAGCAAATCAAGAATGTTACTCAGCACTTTCTGGACGATGGAGTTGTTTCATTTCCCTTGGTGAGAGAG
GGTCACGTCCGACCTGGAGATGCCAAAGGTAAAGAGCA
TTTTGGGTTTGCAGATGGAATCAGCCAGCCTTTCATCCAAGGCTTGGACGATACTGTTCCCAACGCGAAATTGCCCAAGGAC
AAGGAGCCGAAGGCTTCCGACGCAGG
GTTAATTCTGTGTGGACACAAAGGCGATCCAATGAAGCAGCCGTCATGGAGCCACGATGGTAGCTTCCTTGTGATTAGAGATCTGCAGCAGATG
GTCCCCGAATTCGAAGA
ATGGCTCCAGAAAAATGGCCCCAAGGCTCCTTTCTGCCAAGGCTCCGATAAGCCAGCAGAAAAGCTTGCGGCATATCTGATGGGCAGATGGAGGAACGGAACA
CCTGTCCACGAGAGCCCCCACAGCGACGAGGACGAGAGCTTACACGCATCCAATGCCTTCGACTACGAGCCTCGAGACAAGCATGACAAGTGTCCGTTCGCGGCCCACACGCGAAAAATG
CGGCCGAGGTCAGATCTTGGCCATGATCACGCAGTGATTATCCGACGCGGGATCCCGTATGGGCCTGAAGTCAGCGATGAAGAGAAGGCAGCCAAGACCTCGGACACTGCTGCAGAGCGT
GAACGCGGTCTACTCTTTGCTTGCTACCAAAGTGATATTCGCAACGGATTCAATTTCCTGACAACTC
GCTGGGCCAGTCAACACCATTTCCCCACGAACAAGCATGAATCCGTCGGCGAG
GAAGGCCCAGGCATCGACCCCATCGTTGGCCAAAGACTCGACCACCATCCACCGCGATTGATCGCTTTGCCTGACGGCCAAGTCCCTACCAAGCACCGAATGGAACTCGAAAGCTGGGTC
ACTCACAAAGGTGGTGAATATTTTTTCAGCCCATCTATCGAAGCCATCATGGGCTACCTAACAGGACCAAGCGACTACGACTTGGCACCTAGGGCGAAATTGTAA

Retrieve as FASTA