Entry information : HpinDyPrx
Entry ID 10219
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: HpinDyPrx
Name HpinDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hydnomerulius
Organism Hydnomerulius pinastri    [TaxId: 388859 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpinDyPrx
start..stop
S start..stop
PgigDyPrx03 516 4e-179 11..543 9..602
SbreDyPrx01 518 1e-175 1..544 1..582
GluxDyPrx02 504 1e-174 17..545 19..570
SlutDyPrx01 511 9e-173 1..541 1..579
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2214140..2214292 153 N° 2 2213709..2214066 358 N° 3 2213427..2213589 163 N° 4 2213074..2213359 286
N° 5 2212778..2213011 234 N° 6 2212527..2212698 172 N° 7 2212182..2212456 275  
complement(join(2212182..2212456,2212527..2212698,2212778..2213011,2213074..2213 359,2213427..2213589,2213709..2214066,2214140..2214292))


exon

Literature and cross-references HpinDyPrx
DNA ref. JGI genome:   scaffold_1 (2214292..2212182)
Cluster/Prediction ref. JGI gene:   900860
Protein sequence: HpinDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   547
PWM (Da):   %s   60261.12  
PI (pH):   %s   5.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGDAKHSLRFFSPLANRSIIPLLASSGTLPSEPNLPNPSNVQGDIIYQFPKLAEAFIFFRISDVPQFKKALASFNPTPGSQVFNNLCAIRSAKLASGTQRTQSVTLVQRQIAFSRAGLNILDQCEKTGDDRFDTFCMRDNKTYLGDGMPWDKVFDKPNPDPVHGTANEDKDPDECGKAIEAFKQEFQGAINPNDFTVMQGKARPGDQKGHEHFGYMDGISQPAMRGLIAPNPGQIQVDPGVIITGYEGDPMLNKRPHWAKDGTFMVFRKLQQLVPEFQQYLADNGPRWKEFVPKVDTKKELTDKEGAALWGARMIGRWPSGAPIANAPVFDDPAMAQDPKRNNNFDYTIPGYDLPTDKHCPFSAHTRKTAPRNLDPFLAKKFLEGGSIIRAGIPFGDEVSAEEQQAQETDPDPDHWRGLLFVAYQSDLNSGFVRQTVQYANNDYSPTVSLIPKVHGQDPILGGPPHPLSDPITIDKTQPVESGDQVHLTILNAQGDRLDVQGFASLARHGVQPPPGVPQQFFVNSRGGEYFFVPSIETVKALAESQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGACGCCAAACATTCACTTCGGTTCTTCAGCCCGCTGGCTAATCGCAGTATCATCCCTCTCTTAGCATCTTCTGGGACTCTCCCGTCAGAGCCCAACCTCCCTAACCCAAGCAAC
GTCCAGGGGGACATCATTTACCAATTCCCAAAG
GTCTGTTTGAAACTTAGCCTCCACGACCAACGGTCGATTGTTGACCATTTCTCCCCTATGTGCGATAACATAGCTCGCAGAAGCCTT
CATCTTCTTCCGTATTAGCGACGTCCCGCAATTCAAGAAAGCCTTAGCCTCTTTCAACCCAACGCCGGGGTCCCAAGTCTTCAACAACCTCTGCGCCATCCGTTCCGCCAAACTCGCCTC
TGGGACCCAGCGCACCCAGTCAGTCACGCTCGTACAAAGACAGATCGCCTTCTCTCGCGCCGGTCTTAACATCCTCGACCAGTGCGAAAAGACTGGAGACGACCGTTTCGATACGTTCTG
CATGAGGGATAACAAGACGTACCTCGGGGATGGAATGCCATGGGACAAGGTGTTTGATAAGCCGAACCCGGATCCGGTGCATGGAACTGCGAATGAGGACAAGG
GTGCTGTTCATTGTGT
TGTCAGTATTGCTGCAAGTGGTATGTTGGGTCTGCCGTCTGTCTCTCTTCTTGACCTTTACTCCCCTCGTGGCACGCTTTATGGCTGAATACAACCTTCGCAGACCCGGACGAATGTGGA
AAGGCGATAGAGGCCTTCAAACAAGAATTCCAAGGCGCCATCAACCCGAACGACTTCACGGTTATGCAGGGCAAGGCTCGACCCGGTGATCAGAAGGGGCACGAACACTTTGGATATATG
GATGGGATCTCTCAGCCTGCGATGCG
GTATAGTATTGTCCTCAGATCCACTCAAACAACCAGCCAACGTCCTCCTTTTTGCTTTTTAATCCAGGGGTCTCATCGCTCCTAACCCAGGTCA
AATCCAGGTCGATCCAGGGGTCATTATAACAGGCTATGAAGGCGACCCAATGCTCAACAAACGTCCACACTGGGCAAAAGATGGGACGTTTATGGTGTTCCGCAAACTCCAACAGCTGGT
TCCCGAGTTTCAGCAATACCTGGCTGACAATGGTCCACGCTGGAAAGAGTTTGTGCCCAAGGTGGACACAAAGAAGGAGCTTACGGACAAAGAGGGAGCGGCCCTTTGGGGTGCGAGGAT
GATTGGGCGGTGGCCTTCT
GTGAGCAGTCCTTTTCCAAGTTACTATCACCTCGCGNCTCACTGATCTGCTCCTTTCGTTAGGGTGCTCCGATTGCCAACGCGCCCGTCTTTGACGACCCA
GCGATGGCTCAAGATCCGAAAAGGAACAACAATTTCGATTATACGATCCCCGGTTATGACCTCCCCACGGATAAACACTGTCCCTTCTCAGCTCATACGCGCAAGACTGCCCCGCGTAAT
CTCGACCCTTTCCTTGCGAAGAAATTCTTGGAGGGTGGATCCATCATTCGAGCTGGAATTCCATTCGGAGATGAG
GTTAGTTAGCAGGCCACAGTCAGGGGGTGGCGGTGCTGGAAGGAT
GAATGCTCATGTTTTGCCTCTGAATCTGATGTAGGTATCCGCAGAAGAGCAACAAGCCCAGGAGACAGACCCAGATCCGGACCACTGGCGCGGGCTCCTTTTTGTAGCTTACCAATCCGA
CCTGAATTCGGGATTCGTCCGTCAAACTGTTCAATACGCAAACAACGACTACTCCCCGACCGTTTCTCTCATTCCTAAAGTGCACG
GTCAGTCTTCTTGACGTATGTACAGATGAGAATT
GTCCTCACGATAGGCTTCTTCTTCGGCACTTCCCAGGCCAAGATCCCATTCTGGGTGGGCCTCCTCACCCCCTGAGCGACCCCATCACGATAGACAAGACACAGCCAGTAGAATCTGGAG
ACCAGGTCCATCTCACAATCCTCAATGCGCAAGGGGACCGCCTCGATGTCCAAGGGTTTGCCAGTCTGGCAAGACACGGCGTTCAGCCCCCTCCAGGCGTTCCACAACAGTTTTTTGTCA
ACTCGAGGGGAGGGGAGTACTTCTTCGTGCCGTCTATAGAAACGGTGAAAGCGCTTGCGGAGAGTCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGACGCCAAACATTCACTTCGGTTCTTCAGCCCGCTGGCTAATCGCAGTATCATCCCTCTCTTAGCATCTTCTGGGACTCTCCCGTCAGAGCCCAACCTCCCTAACCCAAGCAAC
GTCCAGGGGGACATCATTTACCAATTCCCAAAG
CTCGCAGAAGCCTTCATCTTCTTCCGTATTAGCGACGTCCCGCAATTCAAGAAAGCCTTAGCCTCTTTCAACCCAACGCCGGGGTCC
CAAGTCTTCAACAACCTCTGCGCCATCCGTTCCGCCAAACTCGCCTCTGGGACCCAGCGCACCCAGTCAGTCACGCTCGTACAAAGACAGATCGCCTTCTCTCGCGCCGGTCTTAACATC
CTCGACCAGTGCGAAAAGACTGGAGACGACCGTTTCGATACGTTCTGCATGAGGGATAACAAGACGTACCTCGGGGATGGAATGCCATGGGACAAGGTGTTTGATAAGCCGAACCCGGAT
CCGGTGCATGGAACTGCGAATGAGGACAAGG
ACCCGGACGAATGTGGAAAGGCGATAGAGGCCTTCAAACAAGAATTCCAAGGCGCCATCAACCCGAACGACTTCACGGTTATGCAGGGC
AAGGCTCGACCCGGTGATCAGAAGGGGCACGAACACTTTGGATATATGGATGGGATCTCTCAGCCTGCGATGCG
GGGTCTCATCGCTCCTAACCCAGGTCAAATCCAGGTCGATCCAGGG
GTCATTATAACAGGCTATGAAGGCGACCCAATGCTCAACAAACGTCCACACTGGGCAAAAGATGGGACGTTTATGGTGTTCCGCAAACTCCAACAGCTGGTTCCCGAGTTTCAGCAATAC
CTGGCTGACAATGGTCCACGCTGGAAAGAGTTTGTGCCCAAGGTGGACACAAAGAAGGAGCTTACGGACAAAGAGGGAGCGGCCCTTTGGGGTGCGAGGATGATTGGGCGGTGGCCTTCT
GGTGCTCCGATTGCCAACGCGCCCGTCTTTGACGACCCAGCGATGGCTCAAGATCCGAAAAGGAACAACAATTTCGATTATACGATCCCCGGTTATGACCTCCCCACGGATAAACACTGT
CCCTTCTCAGCTCATACGCGCAAGACTGCCCCGCGTAATCTCGACCCTTTCCTTGCGAAGAAATTCTTGGAGGGTGGATCCATCATTCGAGCTGGAATTCCATTCGGAGATGAG
GTATCC
GCAGAAGAGCAACAAGCCCAGGAGACAGACCCAGATCCGGACCACTGGCGCGGGCTCCTTTTTGTAGCTTACCAATCCGACCTGAATTCGGGATTCGTCCGTCAAACTGTTCAATACGCA
AACAACGACTACTCCCCGACCGTTTCTCTCATTCCTAAAGTGCACG
GCCAAGATCCCATTCTGGGTGGGCCTCCTCACCCCCTGAGCGACCCCATCACGATAGACAAGACACAGCCAGTA
GAATCTGGAGACCAGGTCCATCTCACAATCCTCAATGCGCAAGGGGACCGCCTCGATGTCCAAGGGTTTGCCAGTCTGGCAAGACACGGCGTTCAGCCCCCTCCAGGCGTTCCACAACAG
TTTTTTGTCAACTCGAGGGGAGGGGAGTACTTCTTCGTGCCGTCTATAGAAACGGTGAAAGCGCTTGCGGAGAGTCAGTGA

Retrieve as FASTA