Entry information : HcyDyPrx01
Entry ID 10220
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyDyPrx01
Name HcyDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyDyPrx01
start..stop
S start..stop
GmarDyPrx03 674 0 24..501 26..501
GmarDyPrx02 642 0 25..501 29..499
GmarDyPrx04 630 0 24..501 26..510
AthiDyPrx01 547 0 25..501 5..471
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 183028..183131 104 N° 2 182740..182977 238 N° 3 182378..182679 302 N° 4 182019..182323 305
N° 5 181906..181966 61 N° 6 181580..181851 272 N° 7 181464..181518 55 N° 8 181233..181401 169
complement(join(181233..181401,181464..181518,181580..181851,181906..181966,1820 19..182323,182378..182679,182740..182977,183028..183131))


exon

Literature and cross-references HcyDyPrx01
DNA ref. JGI genome:   scaffold_15 (183131..181233)
Cluster/Prediction ref. JGI gene:   491764
Protein sequence: HcyDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   502
PWM (Da):   %s   55141.68  
PI (pH):   %s   9.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTPQQPLLPVVQPPPGSPPRLDSLKLDNIQGDVLAGLPKKTETLYFFVITDTDKFRHDLRSFNPLVKTVAQVLVDRKAIREHKRKYPPMPGSKPNLIPLVGVNIAFSHFGFKKLGIDDKKLADPAFLAGQRADAEGLHDKGTGTGPSFVPDWEQPFKSEIHGVFLLAGDSRATVDKKLQEIKTIFGVGGPKPSLKEITSVRGDARPGAQSAHEHFGYLDGISNPAIKGFAPDANPPPGPAPIDAGVIVTGHPGDEKQNDREDWQVDGSFLVFRYLFQKVPEFNNFVFENRLKGPGLTDQEGADLLGARLIGRWKSGAPLDITPFIDDPKIGTDPNENNNFHFTAETEVQKLCPFAAHVRKTLPRADLEDRPGNPSIARFRIMRRGIQFGPEVTEKEKMAKKTSHGRGLIFICYQSSIANGFQFIQKNWVDNPNFPPGAPPTQRPGVDPILGQGPGRDKISGHNPNKPTDTLELTDEWIIPRGGEYFFTPSLKGLRERIAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACACCTCAACAACCTCTTCTTCCTGTGGTTCAACCCCCCCCCGGATCCCCACCCCGCCTGGACTCTCTCAAGCTTGACAATATCCAGGGCGATGTTTTGTGAGTATAGATGGGG
TATACATTTCTTCATACGCTGGAGTTTTTTTTAGAGCTGGACTCCCCAAGAAAACCGAGACGTTGTATTTCTTCGTGATTACCGACACTGACAAGTTCAGGCATGATTTACGAAGCTTCA
ACCCTCTCGTAAAGACCGTTGCTCAGGTCCTGGTGGATCGCAAGGCTATCCGAGAACACAAACGTAAATATCCCCCCATGCCCGGATCCAAACCAAATCTCATCCCATTGGTTGGCGTCA
ATATCGCCTTTTCACATTTCGGATTCAAGAAG
GTGACTTAGTCCTGCCACTACAAACCACTAAGGTTCTCACTGATCCCTCGGTGTTTCCAGCTTGGAATCGATGACAAGAAGCTCGCAG
ATCCCGCTTTCCTCGCTGGTCAGCGCGCTGACGCCGAGGGGCTCCACGACAAGGGAACGGGAACTGGTCCGTCATTCGTTCCCGATTGGGAGCAACCCTTTAAATCCGAAATTCATGGCG
TTTTCCTCCTCGCTGGTGACTCCCGCGCTACTGTTGACAAGAAGCTTCAAGAGATCAAAACGATCTTCGGAGTTGGAGGGCCTAAACCTTCCCTCAAGGAAATCACTTCTGTTCGCGGTG
ACGCTCGTCCAGGCGCTCAATCTGCACATGAACA
GTAAGCTATAATTATCCGAAGATTACGCGCTTATCGCTTACATGTTATGAATAGTTTCGGGTACCTCGATGGCATCTCCAACCCAG
CGATCAAGGGCTTTGCTCCTGATGCGAACCCGCCCCCAGGACCTGCGCCCATTGATGCGGGCGTCATTGTCACTGGACATCCTGGTGATGAGAAACAGAACGACCGCGAGGATTGGCAAG
TCGACGGAAGCTTCCTTGTCTTCCGATACCTTTTCCAGAAAGTCCCGGAATTCAATAATTTTGTGTTTGAGAACCGTCTCAAGGGCCCAGGATTGACTGACCAAGAAGGAGCAGACCTCT
TGGGAGCAAGATTGATTGGGCGATGGAAGAGCG
GTATGTATCTGAGCTTGCTTTCCTTCCGGCGACACGGACTGACACCTTACAGGTGCCCCACTGGATATCACGCCATTCATTGATGAC
CCTAAGATTGGAACAGATCCTAATGA
GTATGTTGACTCTCTATTCAATGGTTTATTTAACCCATTTAACTAATATTATAGGAATAACAATTTCCACTTTACCGCTGAGACCGAAGTCCAG
AAATTATGCCCTTTCGCTGCGCACGTTCGCAAGACCCTCCCTCGAGCTGATCTAGAAGACCGACCAGGCAACCCCTCCATCGCGCGATTCCGAATTATGCGCCGAGGTATTCAATTTGGA
CCTGAAGTCACTGAGAAAGAGAAGATGGCGAAGAAAACATCACACGGTCGAGGTTTAATTTTCATTTGCTATCAGAGTAGCATTGCCAATGGTTTCCAGTTCATTCAGAAGA
GTGAGTTC
GGGGTTGCACTCTCTTTACCATTTAAGTAAAGGAAATCTGACCTCCATCGCAGACTGGGTCGACAACCCGAACTTCCCTCCCGGCGCCCCTCCCACTCAGCGTCCTGGGTACGTCTTGTT
TACCTATCGGTTTCCTTTCACCTGGCTAACTACGGCTTTGCTTCCTTCAGTGTCGACCCTATCCTTGGCCAAGGGCCAGGTCGTGATAAGATCAGCGGGCACAATCCCAACAAGCCAACT
GACACCCTCGAACTTACAGATGAATGGATTATTCCCCGTGGCGGAGAATATTTCTTCACCCCCTCGCTCAAAGGCTTGAGGGAACGTATCGCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACACCTCAACAACCTCTTCTTCCTGTGGTTCAACCCCCCCCCGGATCCCCACCCCGCCTGGACTCTCTCAAGCTTGACAATATCCAGGGCGATGTTTTAGCTGGACTCCCCAAG
AAAACCGAGACGTTGTATTTCTTCGTGATTACCGACACTGACAAGTTCAGGCATGATTTACGAAGCTTCAACCCTCTCGTAAAGACCGTTGCTCAGGTCCTGGTGGATCGCAAGGCTATC
CGAGAACACAAACGTAAATATCCCCCCATGCCCGGATCCAAACCAAATCTCATCCCATTGGTTGGCGTCAATATCGCCTTTTCACATTTCGGATTCAAGAAG
CTTGGAATCGATGACAAG
AAGCTCGCAGATCCCGCTTTCCTCGCTGGTCAGCGCGCTGACGCCGAGGGGCTCCACGACAAGGGAACGGGAACTGGTCCGTCATTCGTTCCCGATTGGGAGCAACCCTTTAAATCCGAA
ATTCATGGCGTTTTCCTCCTCGCTGGTGACTCCCGCGCTACTGTTGACAAGAAGCTTCAAGAGATCAAAACGATCTTCGGAGTTGGAGGGCCTAAACCTTCCCTCAAGGAAATCACTTCT
GTTCGCGGTGACGCTCGTCCAGGCGCTCAATCTGCACATGAACA
TTTCGGGTACCTCGATGGCATCTCCAACCCAGCGATCAAGGGCTTTGCTCCTGATGCGAACCCGCCCCCAGGACCT
GCGCCCATTGATGCGGGCGTCATTGTCACTGGACATCCTGGTGATGAGAAACAGAACGACCGCGAGGATTGGCAAGTCGACGGAAGCTTCCTTGTCTTCCGATACCTTTTCCAGAAAGTC
CCGGAATTCAATAATTTTGTGTTTGAGAACCGTCTCAAGGGCCCAGGATTGACTGACCAAGAAGGAGCAGACCTCTTGGGAGCAAGATTGATTGGGCGATGGAAGAGCG
GTGCCCCACTG
GATATCACGCCATTCATTGATGACCCTAAGATTGGAACAGATCCTAATGA
GAATAACAATTTCCACTTTACCGCTGAGACCGAAGTCCAGAAATTATGCCCTTTCGCTGCGCACGTTCGC
AAGACCCTCCCTCGAGCTGATCTAGAAGACCGACCAGGCAACCCCTCCATCGCGCGATTCCGAATTATGCGCCGAGGTATTCAATTTGGACCTGAAGTCACTGAGAAAGAGAAGATGGCG
AAGAAAACATCACACGGTCGAGGTTTAATTTTCATTTGCTATCAGAGTAGCATTGCCAATGGTTTCCAGTTCATTCAGAAGA
ACTGGGTCGACAACCCGAACTTCCCTCCCGGCGCCCCT
CCCACTCAGCGTCCTGG
TGTCGACCCTATCCTTGGCCAAGGGCCAGGTCGTGATAAGATCAGCGGGCACAATCCCAACAAGCCAACTGACACCCTCGAACTTACAGATGAATGGATTATT
CCCCGTGGCGGAGAATATTTCTTCACCCCCTCGCTCAAAGGCTTGAGGGAACGTATCGCTGCTTGA

Retrieve as FASTA