Entry information : HcyDyPrx02
Entry ID 10221
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyDyPrx02
Name HcyDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyDyPrx02
start..stop
S start..stop
GmarDyPrx01 732 0 12..486 6..486
HsubDyPrx02 700 0 1..486 1..489
HsubDyPrx01 669 0 6..484 1..489
LbiDyPrx01 644 0 10..484 21..500
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150488..150561 74 N° 2 150211..150427 217 N° 3 149838..150139 302 N° 4 149476..149780 305
N° 5 149362..149422 61 N° 6 149025..149305 281 N° 7 148917..148971 55 N° 8 148696..148861 166
complement(join(148696..148861,148917..148971,149025..149305,149362..149422,1494 76..149780,149838..150139,150211..150427,150488..150561))


exon

Literature and cross-references HcyDyPrx02
DNA ref. JGI genome:   scaffold_23 (150561..148696)
Cluster/Prediction ref. JGI gene:   502048
Protein sequence: HcyDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   486
PWM (Da):   %s   53095.36  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTPAQAPVPASVPLDLENIQGDIFGLPKKTQFYIFFDVTDTKKFREDLNKFIPLIKTVEGVLKDRDAIKDHKKKKLPGLVHIVGVNIAFSHKGFVLGIDDTTLGGVEDPFVIGQKQDAITNLGDPKKADGNPDWDSHFLQEIHGVILISGESHGSIRKTKYEIEHIFGVHSPHASIKEIVTLQGDVRPGDESGHEHFGFLDGISNPVVNGFDTVINPGPKTVDPGVVVTGHTGDITQRADWATDGSFLVFRYLFQHVPEFNDFLKKNPIAKDGDGKVLTPEEGSDLLGARMVGRWKGAPIDITPFKDDPALGTDPKRNNDFAFAGEISSQLRCPFAAHVRKTNPRDDLEVPPPPTPPIAIEGRRIMRRGVQFGPEVTREEAHTAKTQHGRGLLFACYQTSIVNGFQFLQSWANNEKFPPFTGRPEAPGLDPLIGQGDRAMSGLDPLNEQTVIGMPAFIIPRGGEYFFSPSLKGLKSTIASSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACTCCAGCTCAAGCCCCAGTGCCTGCGTCAGTCCCTCTTGACCTCGAGAATATCCAAGGAGATATATTGTAAGCGCCCATTGATGAACAAACGAGTGGTTCGATGCTCACCTAG
GTATTTTGCAGGAGCGGCCTTCCGAAGAAGACCCAATTCTATATCTTCTTCGACGTCACGGACACCAAGAAATTCAGAGAAGACCTCAACAAGTTCATACCTCTCATTAAGACTGTCGAA
GGGGTTTTGAAAGATCGCGATGCTATCAAAGATCACAAGAAGAAGAAACTTCCTGGCCTTGTCCACATCGTCGGCGTGAACATAGCCTTCTCTCACAAAGGATTTGTCAAG
GTCAGTAAA
CATCGTGATTAATTTTTCTTTTGCACGTCGCTTACTCACCGTTTCAATTATGAATCCGACAGCTCGGAATCGACGATACGACACTTGGCGGGGTTGAGGACCCATTCGTAATTGGTCAGA
AGCAGGACGCCATCACCAACCTTGGCGACCCCAAGAAAGCCGATGGAAACCCTGACTGGGACAGCCATTTCCTCCAGGAAATCCATGGCGTTATTCTCATCTCTGGGGAGAGCCATGGGT
CGATCAGGAAGACGAAGTACGAGATCGAACATATCTTCGGCGTGCACTCGCCACATGCATCCATCAAAGAGATCGTTACCCTTCAAGGTGACGTTCGCCCAGGAGATGAATCTGGACATG
AGCA
GTGAGTTACTCTTGATATCGTCAGTGCTTCGCAGAAATATTGAAACATTTAAAACAGCTTCGGTTTCTTGGACGGAATTTCCAACCCAGTTGTTAACGGCTTCGACACCGTCATTA
ACCCAGGCCCAAAGACCGTCGATCCGGGTGTCGTTGTAACCGGACACACTGGGGACATCACCCAAAGGGCGGACTGGGCCACAGACGGAAGCTTCCTCGTCTTCCGTTATCTCTTCCAAC
ACGTACCCGAATTTAACGATTTCCTGAAGAAGAACCCCATCGCCAAGGACGGAGACGGCAAGGTATTGACTCCTGAAGAGGGTAGTGACCTCCTTGGAGCCAGAATGGTTGGACGCTGGA
AGAGTG
GTAAGTCATGATAACAATGACTGTTAACGGCCATACTGAGATTCATAACTCAGGCGCACCCATCGACATTACTCCATTCAAGGATGATCCTGCTCTCGGAACAGACCCAAAGAG
GTACGGTCCCACCCTCCTCAGCAAGACTTCTAGAATGCTGAAAAGGAAGTAACCAGAAACAATGACTTTGCGTTTGCCGGAGAGATCAGCTCCCAGTTGCGTTGCCCGTTCGCTGCCCAT
GTTCGAAAGACCAATCCCCGAGATGACCTCGAGGTACCACCACCCCCGACCCCGCCCATTGCCATCGAAGGCAGGCGCATCATGCGCAGAGGTGTCCAATTTGGCCCAGAAGTTACCCGG
GAGGAAGCGCACACAGCAAAGACCCAGCACGGCCGCGGCCTCTTGTTTGCATGCTACCAGACAAGCATTGTGAACGGCTTCCAGTTCCTCCAGCAAT
GTAAGTTGTTCTTTCCGTTGCCA
AAGAACGTTATACTGATCTAGTGCCCACAGCCTGGGCCAACAACGAGAAATTCCCTCCGTTCACAGGCCGACCAGAGGCTCCAGGGTTCGTATCCTCGTCCCAGTCAACAGATATCTGAA
ATCTTACCGTTGATTGACAGACTGGACCCGCTCATTGGTCAAGGCGACAGAGCCATGTCGGGACTTGACCCTCTCAATGAGCAGACGGTAATCGGGATGCCGGCGTTCATCATTCCCCGT
GGTGGTGAATACTTCTTCTCTCCGTCTTTGAAGGGATTGAAGTCCACAATCGCATCTTCTGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACTCCAGCTCAAGCCCCAGTGCCTGCGTCAGTCCCTCTTGACCTCGAGAATATCCAAGGAGATATATTCGGCCTTCCGAAGAAGACCCAATTCTATATCTTCTTCGACGTCACG
GACACCAAGAAATTCAGAGAAGACCTCAACAAGTTCATACCTCTCATTAAGACTGTCGAAGGGGTTTTGAAAGATCGCGATGCTATCAAAGATCACAAGAAGAAGAAACTTCCTGGCCTT
GTCCACATCGTCGGCGTGAACATAGCCTTCTCTCACAAAGGATTTGTCAAG
CTCGGAATCGACGATACGACACTTGGCGGGGTTGAGGACCCATTCGTAATTGGTCAGAAGCAGGACGCC
ATCACCAACCTTGGCGACCCCAAGAAAGCCGATGGAAACCCTGACTGGGACAGCCATTTCCTCCAGGAAATCCATGGCGTTATTCTCATCTCTGGGGAGAGCCATGGGTCGATCAGGAAG
ACGAAGTACGAGATCGAACATATCTTCGGCGTGCACTCGCCACATGCATCCATCAAAGAGATCGTTACCCTTCAAGGTGACGTTCGCCCAGGAGATGAATCTGGACATGAGCA
CTTCGGT
TTCTTGGACGGAATTTCCAACCCAGTTGTTAACGGCTTCGACACCGTCATTAACCCAGGCCCAAAGACCGTCGATCCGGGTGTCGTTGTAACCGGACACACTGGGGACATCACCCAAAGG
GCGGACTGGGCCACAGACGGAAGCTTCCTCGTCTTCCGTTATCTCTTCCAACACGTACCCGAATTTAACGATTTCCTGAAGAAGAACCCCATCGCCAAGGACGGAGACGGCAAGGTATTG
ACTCCTGAAGAGGGTAGTGACCTCCTTGGAGCCAGAATGGTTGGACGCTGGAAGAGTG
GCGCACCCATCGACATTACTCCATTCAAGGATGATCCTGCTCTCGGAACAGACCCAAAGAGA
AACAATGACTTTGCGTTTGCCGGAGAGATCAGCTCCCAGTTGCGTTGCCCGTTCGCTGCCCATGTTCGAAAGACCAATCCCCGAGATGACCTCGAGGTACCACCACCCCCGACCCCGCCC
ATTGCCATCGAAGGCAGGCGCATCATGCGCAGAGGTGTCCAATTTGGCCCAGAAGTTACCCGGGAGGAAGCGCACACAGCAAAGACCCAGCACGGCCGCGGCCTCTTGTTTGCATGCTAC
CAGACAAGCATTGTGAACGGCTTCCAGTTCCTCCAGCAAT
CCTGGGCCAACAACGAGAAATTCCCTCCGTTCACAGGCCGACCAGAGGCTCCAGGACTGGACCCGCTCATTGGTCAAGGC
GACAGAGCCATGTCGGGACTTGACCCTCTCAATGAGCAGACGGTAATCGGGATGCCGGCGTTCATCATTCCCCGTGGTGGTGAATACTTCTTCTCTCCGTCTTTGAAGGGATTGAAGTCC
ACAATCGCATCTTCTGCCTAA

Retrieve as FASTA