Entry information : BaDyPrx03
Entry ID 10224
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaDyPrx03
Name BaDyPrx03
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaDyPrx03
start..stop
S start..stop
TcuDyPrx01 991 0 1..498 1..498
BaDyPrx09 899 0 1..498 1..496
BaDyPrx11 880 0 1..497 1..496
BaDyPrx02 781 0 1..497 1..494
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64471..64582 112 N° 2 64315..64417 103 N° 3 63927..64260 334 N° 4 63762..63876 115
N° 5 63135..63707 573 N° 6 63014..63080 67 N° 7 62767..62959 193  
complement(join(62767..62959,63014..63080,63135..63707,63762..63876,63927..64260 ,64315..64417,64471..64582))


exon

Literature and cross-references BaDyPrx03
DNA ref. JGI genome:   scaffold_20 (64582..62767)
Cluster/Prediction ref. JGI gene:   72253
Protein sequence: BaDyPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   499 (476)
PWM (Da):   %s   53214.74 (50890.5)  
PI (pH):   %s   4.61 (4.51) Peptide Signal:   %s   cut: 23 range:23-498
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSLFVVSVAVLVGSSSHVNAAKLGARQTRTTPLLTNFPGQAPLPALIQHKTESGANDTVLPLNNIQGDILVGMKKQKERFVFFHVNDATSFKTALKTYVPERITSAAILISDPSQQPLAFVNLGFSNTGLQALGITDDLGDAQFPDGQFADAANLGDDLGQWVAPFTGTTIHGVFLIGSDQDDFLDQFTDDISSTFGASITQVQALSGSARPGDQAGHEHFGFLDGISQPSVTGWETTVFPGQAVVPPGIILTGRDGDTGTRPSWALDGSFMAFRHFQQKVPEFNAYTLANAIPANSAGNLTQQEGAELLGARMFGRWKSGAPIDLAPTADDPALGADPQRNNNFDYSDTLTDETRCPFGAHVRKTNPRQDLGGPVDTFHAMRSSIPYGPETSDAELASGVTAQDRGLLFVEYQSIIGNGFRFQQINWANNANFPFSKPITPGIEPIIGQTTPRTVGGLDPLNQNETFTVPLFVIPKGGEYFFLPSISALTSTIAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCTTGTCGCTGTTTGTCGTGTCGGTCGCCGTACTCGTCGGGTCGAGCTCGCATGTCAATGCTGCTAAACTCGGCGCGAGACAGACGCGTACAACACCCCTCCTCACCAGTACGTCG
TTACTCTGTGTGCGATTGAATTTAGTCTAACCTTGGGTGTTTCAGATTTTCCGGGACAAGCCCCCCTGCCTGCCCTAATTCAGCATAAGACTGAGAGCGGGGCCAACGATACAGTTCTAC
CCCTGAACAACATACAAGGCGACATTTT
GTACGTCTTTTTTTTATTCCACTGCGTCCAGATCCGCTGCTAACGATCATCAAGGGTTGGAATGAAGAAACAGAAGGAACGCTTTGTCTTTT
TCCACGTCAATGACGCGACCTCGTTCAAGACGGCGTTGAAGACATACGTGCCTGAGCGTATCACGTCTGCGGCGATTTTGATTTCAGATCCCTCTCAGCAGCCGCTGGCTTTCGTCAACC
TCGGGTTTTCGAACACAGGCCTCCAGGCGCTTGGAATTACCGACGATCTGGGTGACGCACAATTCCCAGATGGTCAGTTCGCGGACGCCGCAAACCTCGGGGACGACCTCGGCCAATGGG
TGGCGCCCTTCACTGGTACCACCATCCATGGTGTCTTTCTGATTGGTAGTGACCAG
GTGAGTCCGGACAGGGTGTACTCGCGCGCCGCGTGTTAACTTGTTACTAGGATGACTTCTTGGA
TCAGTTCACGGATGATATCTCTTCGACCTTTGGTGCCTCCATCACTCAGGTGCAGGCGCTCAGTGGGTCTGCGCGTCCAGGAGATCAGGCTGGTCATGAAC
GTAGGTTTTCTACTCCGTA
TGCAGTACGATGAAGTAACTCAACCCTTTGTGTAGACTTTGGTTTCCTCGACGGCATCTCACAGCCCTCAGTCACGGGCTGGGAGACGACCGTCTTCCCTGGCCAGGCGGTCGTTCCACC
CGGAATCATCCTCACTGGACGCGATGGAGACACGGGCACCCGACCGTCGTGGGCTCTAGATGGGAGTTTCATGGCATTCCGGCACTTCCAGCAGAAGGTCCCCGAATTCAACGCGTACAC
GCTCGCCAACGCGATACCCGCGAACAGCGCAGGAAACCTCACTCAGCAGGAAGGTGCAGAGCTCCTCGGCGCGCGCATGTTCGGCCGTTGGAAGAGCGGCGCGCCGATCGACCTCGCGCC
GACGGCGGACGACCCAGCGCTCGGTGCCGACCCACAGAGGAACAACAACTTCGATTACTCAGATACGCTGACGGACGAGACGCGCTGCCCCTTCGGTGCGCACGTGAGGAAGACGAACCC
TCGACAAGACCTGGGTGGACCGGTCGACACCTTCCACGCTATGCGGTCGAGTATCCCGTATGGCCCGGAAACATCTGATGCAGAGCTTGCGTCGGGCGTGACTGCGCAAGACCGCGGTCT
TCTTTTTG
GTACGTCTTCTTATTTCAAAGTGTTCTGCGCCAATCGACTGACCGTTCCTGCAGTCGAGTACCAGTCCATTATTGGGAATGGGTTCAGGTTCCAGCAGATCAACTGGGCGAA
CAATGCGAA
GTCAGTGTTTTCGTCGTCTTATTTCGCTTGTGCTGGGTGCTGATGCCCTTGCAGCTTCCCTTTCTCCAAACCGATCACGCCTGGAATTGAGCCTATCATCGGCCAGACGAC
TCCACGCACCGTCGGCGGGCTCGACCCTCTCAATCAGAATGAGACGTTCACAGTCCCGCTGTTTGTAATCCCGAAGGGCGGCGAATACTTTTTCTTGCCCTCTATCTCCGCGCTCACTTC
GACTATTGCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCTTGTCGCTGTTTGTCGTGTCGGTCGCCGTACTCGTCGGGTCGAGCTCGCATGTCAATGCTGCTAAACTCGGCGCGAGACAGACGCGTACAACACCCCTCCTCACCAATTTTCCG
GGACAAGCCCCCCTGCCTGCCCTAATTCAGCATAAGACTGAGAGCGGGGCCAACGATACAGTTCTACCCCTGAACAACATACAAGGCGACATTTT
GGTTGGAATGAAGAAACAGAAGGAA
CGCTTTGTCTTTTTCCACGTCAATGACGCGACCTCGTTCAAGACGGCGTTGAAGACATACGTGCCTGAGCGTATCACGTCTGCGGCGATTTTGATTTCAGATCCCTCTCAGCAGCCGCTG
GCTTTCGTCAACCTCGGGTTTTCGAACACAGGCCTCCAGGCGCTTGGAATTACCGACGATCTGGGTGACGCACAATTCCCAGATGGTCAGTTCGCGGACGCCGCAAACCTCGGGGACGAC
CTCGGCCAATGGGTGGCGCCCTTCACTGGTACCACCATCCATGGTGTCTTTCTGATTGGTAGTGACCAG
GATGACTTCTTGGATCAGTTCACGGATGATATCTCTTCGACCTTTGGTGCC
TCCATCACTCAGGTGCAGGCGCTCAGTGGGTCTGCGCGTCCAGGAGATCAGGCTGGTCATGAAC
ACTTTGGTTTCCTCGACGGCATCTCACAGCCCTCAGTCACGGGCTGGGAGACGACC
GTCTTCCCTGGCCAGGCGGTCGTTCCACCCGGAATCATCCTCACTGGACGCGATGGAGACACGGGCACCCGACCGTCGTGGGCTCTAGATGGGAGTTTCATGGCATTCCGGCACTTCCAG
CAGAAGGTCCCCGAATTCAACGCGTACACGCTCGCCAACGCGATACCCGCGAACAGCGCAGGAAACCTCACTCAGCAGGAAGGTGCAGAGCTCCTCGGCGCGCGCATGTTCGGCCGTTGG
AAGAGCGGCGCGCCGATCGACCTCGCGCCGACGGCGGACGACCCAGCGCTCGGTGCCGACCCACAGAGGAACAACAACTTCGATTACTCAGATACGCTGACGGACGAGACGCGCTGCCCC
TTCGGTGCGCACGTGAGGAAGACGAACCCTCGACAAGACCTGGGTGGACCGGTCGACACCTTCCACGCTATGCGGTCGAGTATCCCGTATGGCCCGGAAACATCTGATGCAGAGCTTGCG
TCGGGCGTGACTGCGCAAGACCGCGGTCTTCTTTTTG
TCGAGTACCAGTCCATTATTGGGAATGGGTTCAGGTTCCAGCAGATCAACTGGGCGAACAATGCGAACTTCCCTTTCTCCAAA
CCGATCACGCCTGGAATTGAGCCTATCATCGGCCAGACGACTCCACGCACCGTCGGCGGGCTCGACCCTCTCAATCAGAATGAGACGTTCACAGTCCCGCTGTTTGTAATCCCGAAGGGC
GGCGAATACTTTTTCTTGCCCTCTATCTCCGCGCTCACTTCGACTATTGCTGCTTGA

Retrieve as FASTA