Entry information : BaDyPrx10
Entry ID 10231
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaDyPrx10
Name BaDyPrx10
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaDyPrx10
start..stop
S start..stop
BaDyPrx08 892 0 1..560 12..570
PcarDyPrx 725 0 1..560 1..561
CcinDyPrx02 547 0 40..560 133..648
GluxDyPrx10 357 2e-117 95..554 69..518
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1365239..1365397 159 N° 2 1365155..1365184 30 N° 3 1365056..1365099 44 N° 4 1364928..1365002 75
N° 5 1364049..1364878 830 N° 6 1363813..1363993 181 N° 7 1363619..1363755 137 N° 8 1363336..1363562 227
complement(join(1363336..1363562,1363619..1363755,1363813..1363993,1364049..1364 878,1364928..1365002,1365056..1365099,1365155..1365184,1365239..1365397))


exon

Literature and cross-references BaDyPrx10
DNA ref. JGI genome:   scaffold_4 (1365397..1363336)
Cluster/Prediction ref. JGI gene:   371576 [Incorrect prediction]
Protein sequence: BaDyPrx10
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   560
PWM (Da):   %s   61932.03  
PI (pH):   %s   6.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYNLVNGSTVVRIAEVEEETSVTLKWYQSLTPVQSKPALFQTTALSSSVAMTMSEDADEFVYTINVFDKAGGSTIPDQVTTLRHTKVAEADPLGLSNIQGDVIPGLPKALEFFYYFQITNISRFKEAFTSFAYPHIITSAELVNNPPPPAKDNPDHPFVGFNVGFSSVGISRFGLDPGAIGDAAFVRGQQADAKALGDAGVQRGEAWSPEWDPEYKANIDGIFLVTAYNKANAEAFIAKLEAAFKWAPDRSSIQKVVSLYGYPRPGEHGQNDHFGYRGGGITNPHIKNVTFTEEKGLPFLGSPIIDLGIIVMGREGDIDQAQRPEWAVDGSLFATRKLNNLVPEFDAYLLREGPKIFPGMDAQKAADKLGARLMGRWKGTPVELSPDHDAPEIAADPKRVNNFEFDQNDIQQKGCPFAAHMRKSNPRNDVPLADRHKHLIRRHNMPYGPEVDDDERKHGTAHDRGLHVVIYQSSIERGFRHIQAWYNEPQFPPGKPTVPGWDPVFGQTGNPNKHRSMSGVDPAYPKKTTTFLDKFVDPRGGEYFFSPSMKTLKNYVCA

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). Incorrect prediction from JGI (2 extra exons in 5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACAATCTCGTCAACGGTTCCACAGTCGTCCGCATCGCTGAGGTCGAGGAAGAGACCAGCGTCACGCTCAAATGGTATCAATCTCTGACCCCAGTCCAGAGTAAGCCCGCTTTATTC
CAGACCACAGCCCTCTCCAGCAGCGTGGCGATGACAATG
GTGAGCTAGCGTTCGCTACTCGTCCAATTGTGGAATATGCTCAAACTCCCTCAGTCAGAGGACGCGGATGAATTTGTGTAC
ACT
GTAAATAAAGTTTCTTACCTTCGCAATGCGTCGGCAGATTTTCATCCTCGAATAGATTAATGTCTTCGACAAGGCTGGAGGAAGCACCATCCCTGATCAGTAGGTCGATAACGATGT
CGTCCGCGGCTGTAGCTGACAAGTATTGTCCACAGAGTGACCACTCTGCGACACACGAAGGTAGCGGAAGCGGATCCTCTCGGCCTCAGCAACATCCAAGGCGACGTCATGTATGTCGTC
ATCCGCTTTTCAGTCACATTCTCTGACACAGGTGTTCAGACCTGGTCTCCCTAAGGCCCTCGAATTTTTCTACTACTTCCAGATCACCAATATTTCACGTTTCAAAGAAGCTTTCACATC
GTTCGCATATCCGCACATCATAACCTCAGCGGAGCTCGTCAACAACCCGCCTCCGCCAGCCAAGGACAATCCCGACCACCCATTCGTAGGATTCAACGTCGGGTTCTCCAGCGTGGGCAT
CTCACGCTTCGGACTTGATCCCGGCGCGATTGGAGACGCTGCGTTCGTTCGCGGGCAGCAGGCAGACGCCAAGGCCCTCGGCGACGCCGGCGTACAGCGTGGCGAGGCATGGTCCCCCGA
ATGGGACCCGGAGTACAAGGCGAACATCGACGGCATCTTCCTCGTCACGGCTTATAACAAGGCGAACGCGGAGGCATTCATCGCCAAACTCGAGGCCGCTTTCAAATGGGCACCGGACCG
CTCGAGCATCCAGAAGGTCGTTTCTCTGTACGGGTACCCGCGCCCGGGCGAGCATGGTCAGAACGACCACTTTGGGTACCGCGGTGGCGGAATTACGAACCCGCATATCAAGAACGTTAC
CTTCACAGAGGAGAAAGGCCTGCCTTTCCTCGGTTCTCCCATCATAGATCTCGGTATCATCGTCATGGGCCGCGAGGGCGACATAGACCAGGCGCAGCGTCCGGAGTGGGCGGTAGACGG
CAGCCTCTTTGCCACCAGAAAGCTCAACAACCTTGTGCCCGAGTTCGATGCGTACCTGCTACGTGAAGGACCTAAAATCTTCCCTGGCATGGACGCGCAGAAGGCCGCAGACAAACTCGG
CGCGCGGCTCATGGGTCGCTGGAAAAACG
GTCCGTCAAAATCGCTTTGTTCACTTCTGCCCGGAGTACTGATTTTGACACCCAGGTACACCTGTTGAGCTGTCTCCAGACCACGACGCCC
CAGAGATCGCCGCAGACCCCAAGCGCGTCAACAACTTCGAGTTCGATCAAAACGACATACAGCAGAAGGGCTGCCCCTTTGCTGCCCACATGCGCAAGTCGAACCCTCGCAACGATGTTC
CCCTCGCCGACAGACACAAGCACCT
GTACGTTGTCTTCCACCTTGCCTTACTCCGCACGCTAACATGGCGTTTGTGTTACAGCATCCGGAGGCATAACATGCCGTACGGTCCTGAGGTAG
ATGACGATGAGCGGAAGCATGGCACAGCACATGACCGCGGACTGCACGTTGTCATCTACCAGAGCAGCATCGAGCGTGGTTTCAGACACATCCAAACCG
GTCAGTCTTTTCATTCTACCC
TGGACTTTCCACGGGACTTATATCCGCTATCGCAGCATGGTACAATGAGCCGCAGTTCCCGCCAGGCAAACCGACTGTGCCAGGCTGGGACCCTGTGTTCGGCCAGACGGGCAACCCCAA
CAAGCATCGCTCCATGAGCGGAGTCGACCCTGCATACCCGAAGAAGACAACGACGTTTTTGGACAAGTTTGTTGATCCTCGTGGCGGAGAGTATTTCTTCTCGCCGAGCATGAAGACTCT
GAAGAATTACGTTTGCGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACAATCTCGTCAACGGTTCCACAGTCGTCCGCATCGCTGAGGTCGAGGAAGAGACCAGCGTCACGCTCAAATGGTATCAATCTCTGACCCCAGTCCAGAGTAAGCCCGCTTTATTC
CAGACCACAGCCCTCTCCAGCAGCGTGGCGATGACAATG
TCAGAGGACGCGGATGAATTTGTGTACACTATTAATGTCTTCGACAAGGCTGGAGGAAGCACCATCCCTGATCAAGTGACC
ACTCTGCGACACACGAAGGTAGCGGAAGCGGATCCTCTCGGCCTCAGCAACATCCAAGGCGACGTCAT
ACCTGGTCTCCCTAAGGCCCTCGAATTTTTCTACTACTTCCAGATCACCAAT
ATTTCACGTTTCAAAGAAGCTTTCACATCGTTCGCATATCCGCACATCATAACCTCAGCGGAGCTCGTCAACAACCCGCCTCCGCCAGCCAAGGACAATCCCGACCACCCATTCGTAGGA
TTCAACGTCGGGTTCTCCAGCGTGGGCATCTCACGCTTCGGACTTGATCCCGGCGCGATTGGAGACGCTGCGTTCGTTCGCGGGCAGCAGGCAGACGCCAAGGCCCTCGGCGACGCCGGC
GTACAGCGTGGCGAGGCATGGTCCCCCGAATGGGACCCGGAGTACAAGGCGAACATCGACGGCATCTTCCTCGTCACGGCTTATAACAAGGCGAACGCGGAGGCATTCATCGCCAAACTC
GAGGCCGCTTTCAAATGGGCACCGGACCGCTCGAGCATCCAGAAGGTCGTTTCTCTGTACGGGTACCCGCGCCCGGGCGAGCATGGTCAGAACGACCACTTTGGGTACCGCGGTGGCGGA
ATTACGAACCCGCATATCAAGAACGTTACCTTCACAGAGGAGAAAGGCCTGCCTTTCCTCGGTTCTCCCATCATAGATCTCGGTATCATCGTCATGGGCCGCGAGGGCGACATAGACCAG
GCGCAGCGTCCGGAGTGGGCGGTAGACGGCAGCCTCTTTGCCACCAGAAAGCTCAACAACCTTGTGCCCGAGTTCGATGCGTACCTGCTACGTGAAGGACCTAAAATCTTCCCTGGCATG
GACGCGCAGAAGGCCGCAGACAAACTCGGCGCGCGGCTCATGGGTCGCTGGAAAAACG
GTACACCTGTTGAGCTGTCTCCAGACCACGACGCCCCAGAGATCGCCGCAGACCCCAAGCGC
GTCAACAACTTCGAGTTCGATCAAAACGACATACAGCAGAAGGGCTGCCCCTTTGCTGCCCACATGCGCAAGTCGAACCCTCGCAACGATGTTCCCCTCGCCGACAGACACAAGCACCT
C
ATCCGGAGGCATAACATGCCGTACGGTCCTGAGGTAGATGACGATGAGCGGAAGCATGGCACAGCACATGACCGCGGACTGCACGTTGTCATCTACCAGAGCAGCATCGAGCGTGGTTTC
AGACACATCCAAACCG
CATGGTACAATGAGCCGCAGTTCCCGCCAGGCAAACCGACTGTGCCAGGCTGGGACCCTGTGTTCGGCCAGACGGGCAACCCCAACAAGCATCGCTCCATGAGC
GGAGTCGACCCTGCATACCCGAAGAAGACAACGACGTTTTTGGACAAGTTTGTTGATCCTCGTGGCGGAGAGTATTTCTTCTCGCCGAGCATGAAGACTCTGAAGAATTACGTTTGCGCC
TAG

Retrieve as FASTA